Property Summary

NCBI Gene PubMed Count 52
PubMed Score 32.97
PubTator Score 38.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis -1.291 2.6e-02
Atopic dermatitis -1.200 1.3e-04
atypical teratoid / rhabdoid tumor -2.200 6.9e-05
Breast cancer -1.300 3.2e-03
breast carcinoma -1.100 1.1e-15
chronic rhinosinusitis -1.256 1.2e-02
colon cancer -2.300 1.6e-03
ductal carcinoma in situ -1.200 4.6e-02
ependymoma 1.200 2.2e-02
interstitial cystitis -1.100 2.5e-02
lung cancer -1.800 9.2e-03
medulloblastoma, large-cell -2.200 8.2e-05
oligodendroglioma 1.300 3.6e-03
ovarian cancer -1.900 4.0e-07
psoriasis -1.200 7.2e-09
subependymal giant cell astrocytoma -1.424 4.8e-02
urothelial carcinoma -1.400 3.7e-02

Gene RIF (25)

AA Sequence

MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEELLLEVN      1 - 70
ETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHELQQIIRDNLYLRTVPC     71 - 140
TTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYEDNYYGTPKPPAEPAPLLLNVTDQILPGATPS    141 - 210
AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQP    211 - 280
EELKEQMDDTKPTKPEDNEEPDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENEL    281 - 350
PYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL    351 - 420
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVV    421 - 490
KLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPD    491 - 560
ITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQ    561 - 630
ILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWEN    631 - 700
QGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSS    701 - 770
GPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY    771 - 840
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEG    841 - 910
FASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNG    911 - 980
QSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSP    981 - 1050
IAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLL   1051 - 1120
DYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRV   1121 - 1190
GDQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD   1191 - 1260
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASPQRAARPRLEE   1261 - 1330
APGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRREGPGAAPAFAGPGGGGSGAL   1331 - 1400
EAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSDKLPSVLKPGASAASR                  1401 - 1455
//

Text Mined References (55)

PMID Year Title