Property Summary

NCBI Gene PubMed Count 49
Grant Count 24
R01 Count 16
Funding $2,136,224.05
PubMed Score 31.61
PubTator Score 38.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
urothelial carcinoma -1.400 0.037
ependymoma 1.200 0.022
oligodendroglioma 1.300 0.004
psoriasis -1.700 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.200 0.000
Atopic dermatitis -1.200 0.000
colon cancer -2.300 0.002
lung cancer -1.800 0.009
active ulcerative colitis -1.291 0.026
interstitial cystitis -1.100 0.025
subependymal giant cell astrocytoma -1.424 0.048
breast carcinoma -1.100 0.000
Breast cancer -1.300 0.003
ductal carcinoma in situ -1.200 0.046
ovarian cancer -1.900 0.000
chronic rhinosinusitis -1.256 0.012

Gene RIF (22)

PMID Text
25517131 MAGI2, SERPINE2, and NT5C3B expression levels are associated with airway wall thickening and additionally with bronchial inflammation, emphysema, and lung function, respectively, all features of chronic obstructive pulmonary disease.
24985972 The expression of MAGI2 mRNA was significantly down-regulated in PC3, LNCaP and DU-145 PCa cell lines.
24608321 In Usher syndrome 1G, mutations in SANS eliminate Magi2 binding and thereby deregulate endocytosis, lead to defective ciliary transport modules and ultimately disrupt photoreceptor cell function inducing retinal degeneration.
24258346 Data show that the miR-134/487b/655 cluster regulates TGF-beta1-induced epithelial-mesenchymal transition and affected the resistance to gefitinib by directly targeting membrane-associated guanylate kinase, WW, and PDZ domain-containing protein 2 (MAGI2).
23754155 MAGI2 enhances the sensitivity of BEL-7404 human hepatocellular carcinoma cells to staurosporine-induced apoptosis by increasing PTEN stability.
22649501 Common variants in MAGI2 gene are associated with increased risk for cognitive impairment in schizophrenic patients.
22381734 Results presented herein provide further evidence for a role of MAGI2 in bipolar affective disorder and schizophrenia etiology.
21515326 there was no association of MAGI2 and PARD3 with IBD.
20668459 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEELLLEVN      1 - 70
ETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHELQQIIRDNLYLRTVPC     71 - 140
TTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYEDNYYGTPKPPAEPAPLLLNVTDQILPGATPS    141 - 210
AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQP    211 - 280
EELKEQMDDTKPTKPEDNEEPDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENEL    281 - 350
PYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL    351 - 420
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVV    421 - 490
KLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPD    491 - 560
ITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQ    561 - 630
ILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWEN    631 - 700
QGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSS    701 - 770
GPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY    771 - 840
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEG    841 - 910
FASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNG    911 - 980
QSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSP    981 - 1050
IAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLL   1051 - 1120
DYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRV   1121 - 1190
GDQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD   1191 - 1260
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASPQRAARPRLEE   1261 - 1330
APGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRREGPGAAPAFAGPGGGGSGAL   1331 - 1400
EAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSDKLPSVLKPGASAASR                  1401 - 1455
//

Text Mined References (52)

PMID Year Title
25517131 2015 Novel genes for airway wall thickness identified with combined genome-wide association and expression analyses.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
24985972 2014 Expression profile of MAGI2 gene as a novel biomarker in combination with major deregulated genes in prostate cancer.
24608321 2014 Phosphorylation of the Usher syndrome 1G protein SANS controls Magi2-mediated endocytosis.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24258346 2014 MiR-134/487b/655 cluster regulates TGF-?-induced epithelial-mesenchymal transition and drug resistance to gefitinib by targeting MAGI2 in lung adenocarcinoma cells.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23754155 2013 MAGI2 enhances the sensitivity of BEL-7404 human hepatocellular carcinoma cells to staurosporine-induced apoptosis by increasing PTEN stability.
23751499 2013 The adhesion protein IgSF9b is coupled to neuroligin 2 via S-SCAM to promote inhibitory synapse development.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...