Property Summary

NCBI Gene PubMed Count 12
PubMed Score 281.53
PubTator Score 1490.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIV      1 - 70
VGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVHYRDD     71 - 140
LDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAF    141 - 210
DYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRAD    211 - 280
PWY                                                                       281 - 283
//

Text Mined References (13)

PMID Year Title