Property Summary

NCBI Gene PubMed Count 10
Grant Count 15
R01 Count 2
Funding $1,953,208.86
PubMed Score 262.21
PubTator Score 1490.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
24211713 TSPAN33 is overexpressed in activated and malignant B cells.

AA Sequence

MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIV      1 - 70
VGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVHYRDD     71 - 140
LDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAF    141 - 210
DYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRAD    211 - 280
PWY                                                                       281 - 283
//

Text Mined References (11)

PMID Year Title
26686862 2016 TspanC8 tetraspanins differentially regulate the cleavage of ADAM10 substrates, Notch activation and ADAM10 membrane compartmentalization.
24211713 2013 TSPAN33 is a novel marker of activated and malignant B cells.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23091066 2012 TspanC8 tetraspanins regulate ADAM10/Kuzbanian trafficking and promote Notch activation in flies and mammals.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17158226 2007 Penumbra encodes a novel tetraspanin that is highly expressed in erythroid progenitors and promotes effective erythropoiesis.
16242907 2005 The phylogenetic analysis of tetraspanins projects the evolution of cell-cell interactions from unicellular to multicellular organisms.
16213355 2005 The human Penumbra gene is mapped to a region on chromosome 7 frequently deleted in myeloid malignancies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...