Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.33
PubTator Score 1.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
acute quadriplegic myopathy 1157 9.7041284637036E-7
Duchenne muscular dystrophy 602 3.87446455965383E-5
ovarian cancer 8492 1.35279771855366E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 9.00293839997208E-4
Multiple myeloma 1328 0.00280518969851762
ductal carcinoma in situ 1745 0.0130140914997324
osteosarcoma 7933 0.0392139523691982
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0412740611068245
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.047950034283577
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0

Expression

Synonym

Accession Q86UB9 Q6AW91 Q8ND01 Q9H6M3
Symbols PMP52

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAALSKSIPHNCYEIGHTWHPSCRVSFLQITGGALEESLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQ      1 - 70
SASFLTANGALYMAFFCILRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIYMANLATETLFRM     71 - 140
GVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSFSPEAAYAKVEQKR    141 - 210
EQHEEKPGRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRH    211 - 280
LFTQPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIIAGFLAGISMMFYKSTTIS    281 - 350
MYLASKLVETMYFKGIEAGKVPYFPHADTIIYSISTAICFQAAVMEVQTLRPSYWKFLLRLTKGKFAVMN    351 - 420
RKVLDVFGTGASKHFQDFIPRLDPRYTTVTPELPTEFS                                    421 - 458
//

Text Mined References (11)

PMID Year Title
24430505 2014 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18637193 2008 Comparative transcriptomics of human multipotent stem cells during adipogenesis and osteoblastogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9915854 1999 Pituitary tumor-transforming gene protein associates with ribosomal protein S10 and a novel human homologue of DnaJ in testicular cells.
More...