Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.22
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Ciliopathy 71 3.612 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma -1.035 1.8e-02
group 3 medulloblastoma 1.100 2.0e-02
ovarian cancer -2.700 2.0e-08
Pick disease -1.500 4.3e-06
progressive supranuclear palsy -1.300 6.2e-03

Synonym

Accession Q86UB2 Q2M1J2 Q9NXM4
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MPNVAETERSNDSGNGEHKSERKSPEENLQGAVKSFCTSASGAPLGPKGDGHYPWSCPVTHTREKIYAIC      1 - 70
SDYAFLNQATSIYKTPNPSRSPCLPDSTSLSAGNNSSRYIGIPTSTSEIIYNEENSLENLSNSLGKLPLA     71 - 140
WEIDKSEFDGVTTNSKHKSGNAKKQVSKRKTSDKKGRYQKECPQHSPLEDIKQRKVLDLRRWYCISRPQY    141 - 210
KTSCGISSLISCWNFLYSTMGAGNLPPITQEEALHILGFQPPFEDIRFGPFTGNTTLMRWFRQINDHFHV    211 - 280
KGCSYVLYKPHGKNKTAGETASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEATPVKANKAFSRGPLS    281 - 350
PQEVEYWILIGESSRKHPAIHCKKWADIVTDLNTQNPEYLDIRHLERGLQYRKTKKVGGNLHCIIAFQRL    351 - 420
NWQRFGLWNFPFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWKKMSSIHERRN    421 - 490
SGYQGYSDYDGND                                                             491 - 503
//

Text Mined References (10)

PMID Year Title