Property Summary

NCBI Gene PubMed Count 57
Grant Count 12
R01 Count 6
Funding $1,205,294.71
PubMed Score 65.98
PubTator Score 402.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (38)

PMID Text
27100670 PBRM1 re-expression led to upregulation of genes involved in cellular adhesion, carbohydrate metabolism, apoptotic process and response to hypoxia, and a downregulation of genes involved in different stages of cell division.
26634388 Functionally, suppression of PBRM1 expression promoted cell proliferation and cell cycle progression
26464681 PBRM1 might involve in the development and progression of breast cancer as a tumor suppressor, and thereby may be a valuable prognostic marker for breast cancer patients.
26452128 Use bioinformatic tools to predict the molecular effects of all mutations lying in PBRM1 genes.
26300218 PBRM1 expression identified 4 clinical subgroups of patients with clear cell renal cell carcinoma who had divergent clinical outcomes.
26178300 our data describe a close interrelation between p53 and PBRM1 in renal cell carcinomas
26117423 The expression of BAF180 promotes UV-induced PCNA ubiquitination during S phase.
26003625 Decreased expression of PBRM1 predicts unfavorable clinical outcome in patients with ccRCC.
25978027 PBRM1 could block the G2/M transition by repressing cyclin B1. The data indicated that PBRM1 functions as a tumor suppressor in bladder cancer by repressing cyclin B1 expression.
25911086 We show for the first time that an inherited mutation in PBRM1 predisposes to RCC.
More...

AA Sequence

MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCE      1 - 70
LFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKL     71 - 140
WDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQK    141 - 210
LPSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIF    211 - 280
YMKKAEIEHHEMAKSSLRMRTPSNLAAARLTGPSHSKGSLGEERNPTSKYYRNKRAVQGGRLSAITMALQ    281 - 350
YGSESEEDAALAAARYEEGESEAESITSFMDVSNPFYQLYDTVRSCRNNQGQLIAEPFYHLPSKKKYPDY    351 - 420
YQQIKMPISLQQIRTKLKNQEYETLDHLECDLNLMFENAKRYNVPNSAIYKRVLKLQQVMQAKKKELARR    421 - 490
DDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGRRLCDLFMVKPSKKDYPDYYK    491 - 560
IILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKEKRKELGPLPD    561 - 630
DDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTI    631 - 700
KKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSH    701 - 770
VPNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLF    771 - 840
QEHMFEVLERARRMNRTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHNDVEKERKEKL    841 - 910
PKEIEEDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHVGDYVYVEPAEANLQPHIVCI    911 - 980
ERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPEN    981 - 1050
FRDEDVFVCESRYSAKTKSFKKIKLWTMPISSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSR   1051 - 1120
AEDNFNLEKEKEDVPVEMSNGEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAY   1121 - 1190
FYGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESR   1191 - 1260
YNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELEGGDDDIEEMG   1261 - 1330
EEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQ   1331 - 1400
HPDYSFGELSRLVGTEWRNLETAKKAEYEERAAKVAEQQERERAAQQQQPSASPRAGTPVGALMGVVPPP   1401 - 1470
TPMGMLNQQLTPVAGMMGGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMN   1471 - 1540
QGVAPMVGTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAY   1541 - 1610
LKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNI   1611 - 1680
RQAYNLENV                                                                1681 - 1689
//

Text Mined References (71)

PMID Year Title
27142060 2016 Identification of the BRD1 interaction network and its impact on mental disorder risk.
27100670 2016 PBRM1 Regulates the Expression of Genes Involved in Metabolism and Cell Adhesion in Renal Clear Cell Carcinoma.
26634388 2016 Inactivating frameshift mutation of PBRM1, a putative tumour suppressor gene, in colorectal cancers.
26464681 2015 Low PBRM1 identifies tumor progression and poor prognosis in breast cancer.
26452128 2015 Computational analysis of the mutations in BAP1, PBRM1 and SETD2 genes reveals the impaired molecular processes in renal cell carcinoma.
26300218 2016 Clear Cell Renal Cell Carcinoma Subtypes Identified by BAP1 and PBRM1 Expression.
26178300 2015 PBRM1 (BAF180) protein is functionally regulated by p53-induced protein degradation in renal cell carcinomas.
26117423 2015 The BAH domain of BAF180 is required for PCNA ubiquitination.
26003625 2015 Decreased PBRM1 expression predicts unfavorable prognosis in patients with clear cell renal cell carcinoma.
25978027 2015 PBRM1 suppresses bladder cancer by cyclin B1 induced cell cycle arrest.
More...