Property Summary

NCBI Gene PubMed Count 84
PubMed Score 316.41
PubTator Score 161.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.200 8.1e-03
colon cancer -1.600 2.0e-02
ependymoma 1.100 1.7e-02
lung cancer 1.900 9.5e-05
malignant mesothelioma -1.500 1.4e-04
oligodendroglioma 1.200 1.5e-02
osteosarcoma 1.281 1.0e-03
ovarian cancer -1.100 2.9e-05

 GWAS Trait (1)

Gene RIF (57)

AA Sequence

MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEP      1 - 70
EEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQ     71 - 140
NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG    141 - 210
HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF    211 - 280
YSGFNSRPRGRVYRGRARATSWYSPY                                                281 - 306
//

Text Mined References (97)

PMID Year Title