Property Summary

NCBI Gene PubMed Count 17
PubMed Score 15.77
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 4.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Progressive multifocal leukoencephalopathy 25 3.046 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 4.2e-05

AA Sequence

MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSKKKRSRSHNKS      1 - 70
RDRKRSRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHS     71 - 140
KSPHFREKSPVREPVDNLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIA    141 - 210
YVEFCEIQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITEDMLR    211 - 280
GIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGTDIT    281 - 350
FPDGDQELDLGSAGGRFQLMAKLAEGAGIQLPSTAAAAAAAAAQAAALQLNGAVPLGALNPAALTALSPA    351 - 420
LNLASQCFQLSSLFTPQTM                                                       421 - 439
//

Text Mined References (21)

PMID Year Title