Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $50,150
PubMed Score 1.36
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86TG1 A8K764 B7WPQ9 D6W5L2 Q8N2R6
Symbols TTN1
TM6P1
TMEM150

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
25608530 TMEM150A is a functional homologue of Sfk1 in mammalian cells and plays a role in the homeostatic regulation of PI(4,5)P2 at the plasma membrane.

AA Sequence

MTAWILLPVSLSAFSITGIWTVYAMAVMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCG      1 - 70
SYPPESCLFSLIGNMGAFMVALICLLRYGQLLEQSRHSWVNTTALITGCTNAAGLLVVGNFQVDHARSLH     71 - 140
YVGAGVAFPAGLLFVCLHCALSYQGATAPLDLAVAYLRSVLAVIAFITLVLSGVFFVHESSQLQHGAALC    141 - 210
EWVCVIDILIFYGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI             211 - 271
//

Text Mined References (14)

PMID Year Title
27321926 2016 Tentonin 3/TMEM150c Confers Distinct Mechanosensitive Currents in Dorsal-Root Ganglion Neurons with Proprioceptive Function.
25608530 2015 Plasticity of PI4KIII? interactions at the plasma membrane.
25416956 2014 A proteome-scale map of the human interactome network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...