Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.36
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MTAWILLPVSLSAFSITGIWTVYAMAVMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCG      1 - 70
SYPPESCLFSLIGNMGAFMVALICLLRYGQLLEQSRHSWVNTTALITGCTNAAGLLVVGNFQVDHARSLH     71 - 140
YVGAGVAFPAGLLFVCLHCALSYQGATAPLDLAVAYLRSVLAVIAFITLVLSGVFFVHESSQLQHGAALC    141 - 210
EWVCVIDILIFYGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI             211 - 271
//

Text Mined References (14)

PMID Year Title