Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.82
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
nasopharyngeal carcinoma -3.100 1.1e-04

Gene RIF (3)

AA Sequence

MYRHGISSQRSWPLWTTIFIFLGVAAILGVTIGLLVHFLAVEKTYYYQGDFHISGVTYNDNCENAASQAS      1 - 70
TNLSKDIETKMLNAFQNSSIYKEYVKSEVIKLLPNANGSNVQLQLKFKFPPAEGVSMRTKIKAKLHQMLK     71 - 140
NNMASWNAVPASIKLMEISKAASEMLTNNCCGRQVANSIITGNKIVNGKSSLEGAWPWQASMQWKGRHYC    141 - 210
GASLISSRWLLSAAHCFAKKNNSKDWTVNFGIVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEV    211 - 280
SFTEYIRKICLPEAKMKLSENDNVVVTGWGTLYMNGSFPVILQEDFLKIIDNKICNASYAYSGFVTDTML    281 - 350
CAGFMSGEADACQNDSGGPLAYPDSRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSKTGL        351 - 416
//

Text Mined References (13)

PMID Year Title