Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.04
PubTator Score 7.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 5.2e-04
Astrocytoma, Pilocytic -1.400 1.7e-04
atypical teratoid/rhabdoid tumor -1.100 9.0e-04
glioblastoma -1.500 8.9e-06
group 3 medulloblastoma -2.000 7.6e-04
ovarian cancer -1.600 1.2e-07
pituitary cancer 1.700 6.3e-06
primitive neuroectodermal tumor -1.100 3.4e-02
psoriasis -3.900 2.3e-107
subependymal giant cell astrocytoma -2.412 5.7e-03

Gene RIF (2)

AA Sequence

MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVS      1 - 70
LFVSWKLCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLST     71 - 140
QTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDN    141 - 210
DDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKT    211 - 280
LNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDN    281 - 350
VDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYN    351 - 420
EAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLVEK    421 - 490
R//

Text Mined References (18)

PMID Year Title