Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $65,926.4
PubMed Score 9.64
PubTator Score 7.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -1.500 0.000
group 3 medulloblastoma -2.000 0.001
primitive neuroectodermal tumor -1.100 0.034
adult high grade glioma -1.700 0.001
atypical teratoid/rhabdoid tumor -1.100 0.001
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -2.412 0.006
ovarian cancer -1.600 0.000
pituitary cancer 1.700 0.000
psoriasis -3.900 0.000

Synonym

Accession Q86SS6
Symbols

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVS      1 - 70
LFVSWKLCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLST     71 - 140
QTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDN    141 - 210
DDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKT    211 - 280
LNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDN    281 - 350
VDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYN    351 - 420
EAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLVEK    421 - 490
R//

Text Mined References (17)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15066994 2004 Regulated exocytosis contributes to protein kinase C potentiation of vanilloid receptor activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12966166 2003 Synaptotagmin IX, a possible linker between the perinuclear endocytic recycling compartment and the microtubules.
More...