Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 0.67

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.91586781239456E-16
lung carcinoma 2844 2.66863369726299E-8
diabetes mellitus 1663 0.00133723919577386


  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.100 0.001
lung carcinoma -1.200 0.000
psoriasis -1.200 0.000

Gene RIF (2)

16753812 A novel member of the EGF-TM7 family was identified in mice, termed FIRE (F4/80 like receptor).
12731063 EMR4 accounts for a genetic difference between humans and primates related to immunity.

AA Sequence

TIINTLQGVLLFVVHCLLNRQVRLIILSVISLVPKSN                                     421 - 457

Text Mined References (8)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
16753812 2006 Gene structure and transcript analysis of the human and mouse EGF-TM7 molecule, FIRE.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
12731063 2003 Inactivation of the EGF-TM7 receptor EMR4 after the Pan-Homo divergence.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12565841 2003 There exist at least 30 human G-protein-coupled receptors with long Ser/Thr-rich N-termini.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.