Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 7.9e-16
lung carcinoma 2843 2.7e-08
diabetes mellitus 1728 1.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.100 1.3e-03
lung carcinoma -1.200 2.7e-08
psoriasis -1.200 7.9e-16

Gene RIF (2)

AA Sequence

MGSRFLLVLLSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAY      1 - 70
CRNKVGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWVSGVKPGFGKQLPGDKRTKHI     71 - 140
CVYWEGSEGGWSTEGCSHVHSNGSYTKCKCFHLSSFAVLVALAPKEDPVLTVITQVGLTISLLCLFLAIL    141 - 210
TFLLCRPIQNTSTSLHLELSLCLFLAHLLFLTGINRTEPEVLCSIIAGLLHFLYLACFTWMLLEGLHLFL    211 - 280
TVRNLKVANYTSTGRFKKRFMYPVGYGIPAVIIAVSAIVGPQNYGTFTCWLKLDKGFIWSFMGPVAVIIL    281 - 350
INLVFYFQVLWILRSKLSSLNKEVSTIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTIGSIIAYSF    351 - 420
TIINTLQGVLLFVVHCLLNRQVRLIILSVISLVPKSN                                     421 - 457
//

Text Mined References (8)

PMID Year Title