Property Summary

NCBI Gene PubMed Count 4
Grant Count 10
R01 Count 6
Funding $2,390,579.84
PubMed Score 163.33
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (1)

PMID Text
16515847 CEI may play an important role in the evolution of higher primates in coordination with the IRX genes

AA Sequence

MVAPAARVFLRAVRAALTSTVPDLLCLLARGSPRGLASGRLPLAVHSAQHGPGSGAPWLRIARRALRFVL      1 - 70
SKHWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLCLRMAPPEPAGSRQRI       71 - 138
//

Text Mined References (5)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
16750006 2006 [High-resolution analysis of chromosome 5 and identification of candidate genes in gastric cancer].
16515847 2006 A novel primate specific gene, CEI, is located in the homeobox gene IRXA2 promoter in Homo sapiens.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.