Property Summary

NCBI Gene PubMed Count 4
PubMed Score 180.59
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (1)

AA Sequence

MVAPAARVFLRAVRAALTSTVPDLLCLLARGSPRGLASGRLPLAVHSAQHGPGSGAPWLRIARRALRFVL      1 - 70
SKHWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLCLRMAPPEPAGSRQRI       71 - 138
//

Text Mined References (5)

PMID Year Title