Property Summary

NCBI Gene PubMed Count 9
Grant Count 10
Funding $508,314.5
PubMed Score 27.42
PubTator Score 16.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25227574 A decreased methylation level at CpG sites of ZAR1 exon 1/intron 1. CpGi could serve as a biomarker for invasive bladder cancer.
24787227 ZAR1 and SFRP4 qMSP could be used as potential biomarker for CC diagnosis
23583134 Hypermethylation of ZAR1 regions is extremely frequent in neuroblastomas and correlates with established markers of progressive disease and outcome.
21206179 Findings indicate that non-promoter hypermethylation of ZAR1 is extremely frequent in diffuse gliomas and pituitary adenomas, but methylation-related aberrant ZAR1 expression is far less likely to be related to glioma tumorigenesis.
20654783 we identified a frequently aberrant methylated region within the Zygote arrest 1 (ZAR1) gene in melanoma and demonstrated a distinct methylation pattern between melanoma and nevus.The involvement of ZAR1 in the carcinogenesis of melanoma remains unclear.
16551357 Zygote arrest 1 (ZAR1) could be implicated in regulation of meiosis and post meiotic differentiation of male and female germ cells through expression of shorter splicing variants. Central role of this gene in early reproductive processes.
12773403 The carboxyl-termini of these ZAR1 proteins contain an important functional domain that is conserved through vertebrate evolution and that may be necessary for normal female reproduction in the transition from oocyte to embryonic life.

AA Sequence

MAALGDEVLDGYVFPACPPCSYRYPYPAATKGKGAAGGSWQQRGRGCLPASSPCSAGAASLSFPGCGRLT      1 - 70
AAEYFDSYQRERLMALLAQVGPGLGPRARRAGSCDVAVQVSPRIDAAVQCSLGRRTLQRRARDPESPAGP     71 - 140
GAEGTTGGGSFSQQPSRRGLEQGSPQNGAPRPMRFPRTVAVYSPLALRRLTAFLEGPGPAAGEQRSGASD    141 - 210
GERGPPPARLQGPEEGEVWTKKAPRRPQSDDDGEAQAAVRASWEQPADGPELPPREAQEGEAAPRSALRS    211 - 280
PGQPPSAGRARDGGDGREAAVAGEGPSPRSPELGKERLRFQFLEQKYGYYHCKDCNIRWESAYVWCVQGT    281 - 350
NKVYFKQFCRTCQKSYNPYRVEDITCQSCKQTRCSCPVKLRHVDPKRPHRQDLCGRCKGKRLSCDSTFSF    351 - 420
KYII                                                                      421 - 424
//

Text Mined References (9)

PMID Year Title
25227574 2015 Identification of frequent differentially methylated region in sporadic bladder cancers.
24787227 2014 Evaluation of ZAR1 and SFRP4 methylation status as potentials biomarkers for diagnosis in cervical cancer: exploratory study phase I.
23583134 2013 Non-promoter DNA hypermethylation of Zygote Arrest 1 (ZAR1) in neuroblastomas.
21206179 2010 Aberrant hypermethylation of non-promoter zygote arrest 1 (ZAR1) in human brain tumors.
20654783 2010 Identification and analysis of an early diagnostic marker for malignant melanoma: ZAR1 intra-genic differential methylation.
16551357 2006 Zygote arrest 1 gene in pig, cattle and human: evidence of different transcript variants in male and female germ cells.
12773403 2003 Zygote arrest 1 (Zar1) is an evolutionarily conserved gene expressed in vertebrate ovaries.
12539046 2003 Zygote arrest 1 (Zar1) is a novel maternal-effect gene critical for the oocyte-to-embryo transition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.