Property Summary

NCBI Gene PubMed Count 10
PubMed Score 33.28
PubTator Score 18.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.096 0.009

Synonym

Accession Q86SG2 Q711K7 Q8NAJ7
Symbols DARP
MARP3

Gene

Gene RIF (1)

PMID Text
25125175 Report structure activity relationships for ANKRD23.

AA Sequence

MDFISIQQLVSGERVEGKVLGFGHGVPDPGAWPSDWRRGPQEAVAREKLKLEEEKKKKLERFNSTRFNLD      1 - 70
NLADLENLVQRRKKRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAAENQEYLIDKYLTDGGDPNAH     71 - 140
DKLHRTALHWACLKGHSQLVNKLLVAGATVDARDLLDRTPVFWACRGGHLVILKQLLNQGARVNARDKIG    141 - 210
STPLHVAVRTRHPDCLEHLIECGAHLNAQDKEGDTALHEAVRHGSYKAMKLLLLYGAELGVRNAASVTPV    211 - 280
QLARDWQRGIREALQAHVAHPRTRC                                                 281 - 305
//

Text Mined References (10)

PMID Year Title
25125175 2014 Probing muscle ankyrin-repeat protein (MARP) structure and function.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15238456 2004 Altered titin expression, myocardial stiffness, and left ventricular function in patients with dilated cardiomyopathy.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583192 2003 The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a family of titin filament-based stress response molecules.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456686 2003 Molecular identification and characterization of a novel nuclear protein whose expression is up-regulated in insulin-resistant animals.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.