Property Summary

NCBI Gene PubMed Count 10
PubMed Score 37.82
PubTator Score 18.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 9.5e-03

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.096 9.5e-03

Synonym

Accession Q86SG2 Q711K7 Q8NAJ7
Symbols DARP
MARP3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MDFISIQQLVSGERVEGKVLGFGHGVPDPGAWPSDWRRGPQEAVAREKLKLEEEKKKKLERFNSTRFNLD      1 - 70
NLADLENLVQRRKKRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAAENQEYLIDKYLTDGGDPNAH     71 - 140
DKLHRTALHWACLKGHSQLVNKLLVAGATVDARDLLDRTPVFWACRGGHLVILKQLLNQGARVNARDKIG    141 - 210
STPLHVAVRTRHPDCLEHLIECGAHLNAQDKEGDTALHEAVRHGSYKAMKLLLLYGAELGVRNAASVTPV    211 - 280
QLARDWQRGIREALQAHVAHPRTRC                                                 281 - 305
//

Text Mined References (10)

PMID Year Title