Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $534,322.45
PubMed Score 4.67
PubTator Score 8.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86SF2 B3KQU3 Q7Z5W7 Q9UJ28
Symbols GalNAcT7
GALNAC-T7

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
25809707 GALNT7 and CDK16 were confirmed to be the direct targets of miR-494. These results suggested that miR-494 play an inhibitory role in the tumorigenesis of NPC
24482044 The study of miR-34a, miR-34c and its novel target, GALNT7, may serve as novel potential makers for laryngeal squamous cell carcinoma therapy.
22399294 miR-214 is a new regulator of GALNT7, and both miR-214 and GALNT7 play important roles in the pathogenesis of cervical cancer
21741600 Ectopic expression of miR-30b/30d promoted the metastatic behavior of melanoma cells by directly targeting the GalNAc transferase GALNT7.
19844573 MicroRNA miR-378 regulates nephronectin expression modulating osteoblast differentiation by targeting GalNT-7

AA Sequence

MRLKIGFILRSLLVVGSFLGLVVLWSSLTPRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVV      1 - 70
PWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEP     71 - 140
EPPGVVGGPGEKAKPLVLGPEFKQAIQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDENLLTSS    141 - 210
VVIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGL    211 - 280
IQARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIPQGGGDEDG    281 - 350
YARGAWDWSMLWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEIS    351 - 420
YKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDYFYASRPESQAL    421 - 490
PYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPPKNVDWGEIRGFETAYCIDSMGKTNGGFVELG    491 - 560
PCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHCNLNEFKEWQYFKNLHRFTHIPSGKCLDRSE    561 - 630
VLHQVFISNCDSSKTTQKWEMNNIHSV                                               631 - 657
//

Text Mined References (15)

PMID Year Title
25809707 2015 Functional elucidation of miR-494 in the tumorigenesis of nasopharyngeal carcinoma.
24482044 2014 MicroRNA?34a/c function as tumor suppressors in Hep?2 laryngeal carcinoma cells and may reduce GALNT7 expression.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22399294 2012 MicroRNA-214 suppresses growth and invasiveness of cervical cancer cells by targeting UDP-N-acetyl-?-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7.
21741600 2011 miR-30b/30d regulation of GalNAc transferases enhances invasion and immunosuppression during metastasis.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19844573 2009 MicroRNA miR-378 regulates nephronectin expression modulating osteoblast differentiation by targeting GalNT-7.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...