Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
Funding $235,153
PubMed Score 1.99
PubTator Score 2.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86SE9 B7Z892 D3DR33 Q6PK47 Q86TD0
Symbols RNF159

Gene

PANTHER Protein Class (2)

PDB

4S3O  

 GO Function (1)

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLR      1 - 70
LDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVDEEGDENEDDKDYHRSDPQIA     71 - 140
ICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFI    141 - 210
YMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRIDFG                            211 - 256
//

Text Mined References (19)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25519132 2014 An AUTS2-Polycomb complex activates gene expression in the CNS.
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
21859857 2011 Ehrlichia chaffeensis TRP120 interacts with a diverse array of eukaryotic proteins involved in transcription, signaling, and cytoskeleton organization.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
19273555 2009 An Ehrlichia chaffeensis tandem repeat protein interacts with multiple host targets involved in cell signaling, transcriptional regulation, and vesicle trafficking.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...