Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.43
PubTator Score 2.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.200 2.4e-03
aldosterone-producing adenoma -1.366 2.6e-02
Astrocytoma, Pilocytic 1.200 7.0e-05
atypical teratoid / rhabdoid tumor -1.300 1.2e-02
Breast cancer -2.100 3.4e-16
ductal carcinoma in situ -1.200 4.4e-05
ependymoma 1.700 3.4e-10
group 3 medulloblastoma -2.800 4.8e-06
invasive ductal carcinoma -1.500 4.6e-04
juvenile dermatomyositis 1.214 5.5e-09
lung adenocarcinoma -1.400 2.2e-12
medulloblastoma, large-cell -3.600 8.5e-04
non-small cell lung cancer -1.094 8.8e-15
osteosarcoma -1.126 2.1e-02
ovarian cancer -1.600 1.0e-03
pancreatic ductal adenocarcinoma liver m... -1.316 4.7e-02
primitive neuroectodermal tumor -1.400 1.9e-02
progressive supranuclear palsy -1.200 3.4e-02
psoriasis 1.300 1.4e-15
Rheumatoid arthritis 1.400 3.4e-02
sarcoidosis 1.100 1.1e-02
subependymal giant cell astrocytoma 1.357 4.4e-02

 GO Function (1)

Gene RIF (1)

AA Sequence

MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLR      1 - 70
LDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVDEEGDENEDDKDYHRSDPQIA     71 - 140
ICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFI    141 - 210
YMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRIDFG                            211 - 256
//

Text Mined References (21)

PMID Year Title