Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 12.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
acute quadriplegic myopathy 1.672 4.0e-04
adrenocortical carcinoma -2.147 1.8e-05
astrocytoma 1.100 1.2e-05
atypical teratoid / rhabdoid tumor -2.100 2.2e-04
autosomal dominant Emery-Dreifuss muscul... 1.570 1.1e-03
Breast cancer 2.100 1.2e-09
cystic fibrosis -2.222 5.4e-05
ependymoma -1.600 3.9e-03
fascioscapulohumeral muscular dystrophy 1.370 5.1e-05
fibroadenoma -1.700 1.5e-02
gastric carcinoma 2.200 1.1e-02
glioblastoma multiforme 1.200 1.9e-07
group 4 medulloblastoma -2.500 9.3e-05
interstitial cystitis 1.700 5.9e-04
intraductal papillary-mucinous adenoma (... -3.600 1.2e-05
intraductal papillary-mucinous carcinoma... -4.700 2.3e-05
intraductal papillary-mucinous neoplasm ... -4.800 6.4e-05
juvenile dermatomyositis 2.018 6.6e-10
limb girdle muscular dystrophy 2B 1.149 4.2e-03
lung adenocarcinoma -1.300 2.6e-04
nasopharyngeal carcinoma 1.500 4.1e-04
non-small cell lung cancer -2.120 5.0e-14
oligodendroglioma 1.400 2.2e-07
pancreatic cancer 3.900 1.1e-04
pancreatic ductal adenocarcinoma liver m... -1.779 7.0e-03
pituitary cancer -2.700 6.4e-06
psoriasis -1.300 4.6e-03
sarcoidosis -1.200 3.8e-02
tuberculosis -2.800 2.5e-05
ulcerative colitis 3.600 2.9e-06

AA Sequence

MGNKQPQKVTVPTGTALQGVVLIVSTLHQPGGWICGKDPCCSLRPLSNSVQNALACKSKQDYQAGILFKT      1 - 70
RAFISRDCGSDAAEDSASKGETYTLTLEHKGAGEGDLRPRGQPGWCRLGDPRRDSARPVAAIEGPCPGAA     71 - 140
RASRVLRGRGFSRNPRGRGLPSGAGWRGAGGAGEGAVTFPERRGDVRRKGAGRARFKWHSLSSELRAVWA    141 - 210
AAGYISREPGRRGADGDSSGGERLGARRNSAPRAPCPPTGPPARPPSRGAPARAREGRRHPAADLDPPPG    211 - 280
EPPAAASRGAPAQRPPSESPGAPPPGPADAGGAMAAKPGELMGICSSYQAVMPHFVCLADEFPQPVRPAK    281 - 350
LPKGRGRLRRPRQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSC    351 - 420
KLRNSLDSSDSDSAL                                                           421 - 435
//

Text Mined References (6)

PMID Year Title