Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 12.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 5.00677742371141E-14
juvenile dermatomyositis 1189 6.58509521688796E-10
Breast cancer 3099 1.23126775734487E-9
glioblastoma multiforme 347 1.92120265115988E-7
oligodendroglioma 2849 2.18596139518327E-7
psoriasis 6685 1.64220282847351E-6
ulcerative colitis 2087 2.94113328147593E-6
posterior fossa group B ependymoma 1530 3.22816330076998E-6
pituitary cancer 1972 6.3726027725811E-6
astrocytoma 1493 1.1772662493731E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.24542107080503E-5
tuberculosis and treatment for 3 months 327 1.54713162574468E-5
atypical teratoid/rhabdoid tumor 1095 1.71491014805481E-5
adrenocortical carcinoma 1427 1.76290546001125E-5
primary pancreatic ductal adenocarcinoma 1271 1.8602545790712E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.28169599226612E-5
fascioscapulohumeral muscular dystrophy 100 5.0680325348914E-5
cystic fibrosis 1670 5.42584886510778E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.36700453200354E-5
group 4 medulloblastoma 1875 9.34272161618723E-5
pancreatic cancer 2300 1.0889864344936E-4
lung adenocarcinoma 2714 2.61103897832925E-4
acute quadriplegic myopathy 1157 3.97024577937327E-4
nasopharyngeal carcinoma 1056 4.06189683560179E-4
interstitial cystitis 2299 5.85732235127916E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00112720100893295
limb girdle muscular dystrophy 2B 74 0.00422795346127609
gastric carcinoma 832 0.00978306647034643
fibroadenoma 557 0.0147251788174436
sarcoidosis 368 0.0384309432897231

Expression

AA Sequence

MGNKQPQKVTVPTGTALQGVVLIVSTLHQPGGWICGKDPCCSLRPLSNSVQNALACKSKQDYQAGILFKT      1 - 70
RAFISRDCGSDAAEDSASKGETYTLTLEHKGAGEGDLRPRGQPGWCRLGDPRRDSARPVAAIEGPCPGAA     71 - 140
RASRVLRGRGFSRNPRGRGLPSGAGWRGAGGAGEGAVTFPERRGDVRRKGAGRARFKWHSLSSELRAVWA    141 - 210
AAGYISREPGRRGADGDSSGGERLGARRNSAPRAPCPPTGPPARPPSRGAPARAREGRRHPAADLDPPPG    211 - 280
EPPAAASRGAPAQRPPSESPGAPPPGPADAGGAMAAKPGELMGICSSYQAVMPHFVCLADEFPQPVRPAK    281 - 350
LPKGRGRLRRPRQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSC    351 - 420
KLRNSLDSSDSDSAL                                                           421 - 435
//

Text Mined References (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.