Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 32.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 5.61902163485565E-4
group 3 medulloblastoma 2254 6.74284101751693E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00427863739369082
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0158171427106176
non primary Sjogren syndrome sicca 840 0.0257487047116886

Expression

Synonym

Accession Q7Z7K0 Q68DJ7 Cmc1p
Symbols C3orf68

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYND      1 - 70
PAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM                                       71 - 106
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18443040 2008 Cmc1p is a conserved mitochondrial twin CX9C protein involved in cytochrome c oxidase biogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.