Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 32.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYND      1 - 70
PAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM                                       71 - 106
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18443040 2008 Cmc1p is a conserved mitochondrial twin CX9C protein involved in cytochrome c oxidase biogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.