Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 32.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q7Z7K0 Q68DJ7 Cmc1p
Symbols C3orf68

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYND      1 - 70
PAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM                                       71 - 106
//

Text Mined References (11)

PMID Year Title