Property Summary

NCBI Gene PubMed Count 20
PubMed Score 2.05
PubTator Score 2.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.9e-07

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.800 2.9e-07

 IMPC Phenotype (1)

Gene RIF (7)

AA Sequence

MAAAVAGMLRGGLLPQAGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPS      1 - 70
PPQEEIGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKY     71 - 140
QNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGCIDDTILSRQGFINYSKLPSLPLVQGELVGG    141 - 210
LTCLTAQTHSLLQHQPLQLTTLLDQYIREQREKDSVMSANGKPDPDTVPDS                       211 - 261
//

Text Mined References (25)

PMID Year Title