Property Summary

NCBI Gene PubMed Count 12
PubMed Score 56.89
PubTator Score 1.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z7H5 A4D2K8 B4DFJ4 Q56VW3 Q7Z432 Q8N2P6
Symbols HNLF
ERS25
p24a3
GMP25iso
p24alpha3

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with transmembrane emp24 protein transport domain containing 4 (TMED4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18326488 ERS25 may play a critical role in regulation of heat-shock response and apoptosis

AA Sequence

MAGVGAGPLRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLP      1 - 70
STPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEH     71 - 140
ANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTVILILTG    141 - 210
IWQMRHLKSFFEAKKLV                                                         211 - 227
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18326488 2008 Novel oxidative stress-responsive gene ERS25 functions as a regulator of the heat-shock and cell death response.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...