Property Summary

NCBI Gene PubMed Count 12
PubMed Score 61.89
PubTator Score 1.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (2)

AA Sequence

MAGVGAGPLRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLP      1 - 70
STPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEH     71 - 140
ANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTVILILTG    141 - 210
IWQMRHLKSFFEAKKLV                                                         211 - 227
//

Text Mined References (17)

PMID Year Title