Property Summary

NCBI Gene PubMed Count 11
Grant Count 31
R01 Count 1
Funding $5,292,860.83
PubMed Score 422.60
PubTator Score 39.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
chronic lymphosyte leukemia 2.600 0.000
interstitial cystitis 1.500 0.012

Gene RIF (3)

PMID Text
25591661 CLNK and ZNF518B SNPs may have potential as diagnostic and prognostic marker for Chinese gout patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MNRQGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDGAKGHSDDDYD      1 - 70
DPELRMEETWQSIKILPARPIKESEYADTHYFKVAMDTPLPLDTRTSISIGQPTWNTQTRLERVDKPISK     71 - 140
DVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPLPPEPESSRPPLSQRHTFPEVQRMPSQISLRDLSE    141 - 210
VLEAEKVPHNQRKPESTHLLENQNTQEIPLAISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPH    211 - 280
ENILPYKYTSWRPPFPKRSDRKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAV    281 - 350
FYENKVYNVKIRFLERNQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLP    351 - 420
LTRHLLPL                                                                  421 - 428
//

Text Mined References (13)

PMID Year Title
25591661 2015 Genetic variations in the CLNK gene and ZNF518B gene are associated with gout in case-control sample sets.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...