Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.17
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 4.4e-11
ovarian cancer 8520 2.5e-07

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.100 4.4e-11
ovarian cancer 1.100 2.5e-07

Gene RIF (1)

AA Sequence

MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYRE      1 - 70
PRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK                 71 - 128
//

Text Mined References (17)

PMID Year Title