Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.50
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
18343807 HEL-75 is a new beta-defensin expressed in the epididymis and on sperm. The encoded protein displays antimicrobial activity against E. coli.

AA Sequence

MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQL      1 - 70
IGNHWQSRRRNTQRKDKKQQTTVTS                                                  71 - 95
//

Text Mined References (8)

PMID Year Title
18416833 2008 Directional and balancing selection in human beta-defensins.
18390568 2008 Transcriptome analysis of a cDNA library from adult human epididymis.
18343807 2008 Cloning and identification of a novel sperm binding protein, HEL-75, with antibacterial activity and expressed in the human epididymis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12620395 2003 Distribution of new human beta-defensin genes clustered on chromosome 20 in functionally different segments of epididymis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.