Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.50
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ductal carcinoma in situ 1745 1.2e-03
invasive ductal carcinoma 2951 4.2e-03

Gene RIF (1)

AA Sequence

MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQL      1 - 70
IGNHWQSRRRNTQRKDKKQQTTVTS                                                  71 - 95
//

Text Mined References (8)

PMID Year Title