Property Summary

NCBI Gene PubMed Count 6
PubMed Score 14.02
PubTator Score 16.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (1)

AA Sequence

MPAPPCASCHAARAALRRPLSGQALCGACFCAAFEAEVLHTVLAGRLLPPGAVVAVGASGGKDSTVLAHV      1 - 70
LRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRS     71 - 140
RSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGSPGEGGALPRC    141 - 210
RPLQFASQKEVVLYAHFRRLDYFSEECVYAPEAFRGHARDLLKRLEAARPSAVLDLVHSAERLALAPAAR    211 - 280
PPRPGACSRCGALASRALCQACALLDGLNRGRPRLAIGKGRRGLDEEATPGTPGDPARPPASKAVPTF      281 - 348
//

Text Mined References (11)

PMID Year Title