Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.91
PubTator Score 2.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.22357045133348E-10
tuberculosis 1563 1.10686079564105E-5
fascioscapulohumeral muscular dystrophy 100 7.09658263249203E-5
pituitary cancer 1972 1.05127670511103E-4
medulloblastoma 1524 7.1911413212276E-4
pilocytic astrocytoma 3086 0.00166614576452561
nasopharyngeal carcinoma 1056 0.00235184032912505
medulloblastoma, large-cell 6234 0.00251273048842685
glioblastoma 5572 0.00271263390158036
primitive neuroectodermal tumor 3031 0.00577753477737568
invasive ductal carcinoma 2950 0.0103374092400525
urothelial carcinoma 318 0.014618062343784
active ulcerative colitis 477 0.02371104438709
astrocytic glioma 2241 0.0240140891836553
spina bifida 1064 0.0294440173606223
oligodendroglioma 2849 0.0319118412625312
subependymal giant cell astrocytoma 2287 0.0417464784034891
Endometriosis 535 0.0496271133117716
Disease Target Count Z-score Confidence
Severe pre-eclampsia 2 3.104 1.6

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -1.600 0.015
astrocytic glioma -1.500 0.024
oligodendroglioma -1.400 0.032
glioblastoma -1.400 0.003
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -1.300 0.003
primitive neuroectodermal tumor -1.400 0.006
fascioscapulohumeral muscular dystrophy 1.028 0.000
tuberculosis -1.800 0.000
active ulcerative colitis 1.494 0.024
pilocytic astrocytoma -1.200 0.002
subependymal giant cell astrocytoma -1.333 0.042
nasopharyngeal carcinoma -1.100 0.002
psoriasis -1.500 0.000
Endometriosis -1.186 0.050
spina bifida -1.516 0.029
invasive ductal carcinoma 1.200 0.010
pituitary cancer -1.500 0.000

Synonym

Accession Q7Z713
Symbols Lrp2bp

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
19491311 ANKRD37 is a direct HIF-1 target that is highly induced in hypoxia.

AA Sequence

MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHK      1 - 70
AAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVL     71 - 140
RQKRSLGSVENTSGKRKC                                                        141 - 158
//

Text Mined References (5)

PMID Year Title
19491311 2009 An integrative genomics approach identifies Hypoxia Inducible Factor-1 (HIF-1)-target genes that form the core response to hypoxia.
15809689 2005 Molecular cloning and characterization of a novel human gene containing 4 ankyrin repeat domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.