Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.25
PubTator Score 2.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis 1.494 2.4e-02
astrocytic glioma -1.500 2.4e-02
Astrocytoma, Pilocytic -1.300 1.2e-03
Endometriosis -1.186 5.0e-02
fascioscapulohumeral muscular dystrophy 1.028 7.1e-05
glioblastoma -1.400 2.7e-03
group 4 medulloblastoma -1.100 2.9e-02
invasive ductal carcinoma 1.200 1.0e-02
medulloblastoma, large-cell -1.300 2.5e-03
nasopharyngeal carcinoma -1.100 2.4e-03
oligodendroglioma -1.400 3.2e-02
pituitary cancer -1.500 1.1e-04
primitive neuroectodermal tumor -1.400 5.8e-03
psoriasis -1.500 3.2e-10
spina bifida -1.516 2.9e-02
subependymal giant cell astrocytoma -1.333 4.2e-02
tuberculosis -1.800 1.1e-05
urothelial carcinoma -1.600 1.5e-02

Synonym

Accession Q7Z713
Symbols Lrp2bp

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHK      1 - 70
AAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVL     71 - 140
RQKRSLGSVENTSGKRKC                                                        141 - 158
//

Text Mined References (5)

PMID Year Title