Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.91
PubTator Score 2.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -1.600 0.015
astrocytic glioma -1.500 0.024
oligodendroglioma -1.400 0.032
glioblastoma -1.400 0.003
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -1.300 0.003
primitive neuroectodermal tumor -1.400 0.006
fascioscapulohumeral muscular dystrophy 1.028 0.000
tuberculosis -1.800 0.000
active ulcerative colitis 1.494 0.024
pilocytic astrocytoma -1.200 0.002
subependymal giant cell astrocytoma -1.333 0.042
nasopharyngeal carcinoma -1.100 0.002
psoriasis -1.500 0.000
Endometriosis -1.186 0.050
spina bifida -1.516 0.029
invasive ductal carcinoma 1.200 0.010
pituitary cancer -1.500 0.000

Gene RIF (1)

PMID Text
19491311 ANKRD37 is a direct HIF-1 target that is highly induced in hypoxia.

AA Sequence

MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHK      1 - 70
AAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVL     71 - 140
RQKRSLGSVENTSGKRKC                                                        141 - 158
//

Text Mined References (5)

PMID Year Title
19491311 2009 An integrative genomics approach identifies Hypoxia Inducible Factor-1 (HIF-1)-target genes that form the core response to hypoxia.
15809689 2005 Molecular cloning and characterization of a novel human gene containing 4 ankyrin repeat domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.