Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.58
PubTator Score 3.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (3)

PMID Text
24613307 required for optimal autophagy initiation
19390624 No association between genetic variants in PNPLA5 genes and childhood and adolescent obesity
19390624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGFLEEEGRWNLSFSGAGYLGAHHVGATECLRQRAPRLLQGARRIYGSSSGALNAVSIVCGKSVDFCCSH      1 - 70
LLGMVGQLERLSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFLVTDFATCDEL     71 - 140
IQALVCTLYFPFYCGLIPPEFRGERYIDGALSNNLPFADCPSTITVSPFHGTVDICPQSTSPNLHELNVF    141 - 210
NFSFQISTENFFLGLICLIPPSLEVVADNCRQGYLDALRFLERRGLTKEPVLWTLVSKEPPAPADGNWDA    211 - 280
GCDQRWKGGLSLNWKVPHVQVKDVPNFEQLSPELEAALKKACTRDPSRWARFWHSGPGQVLTYLLLPCTL    281 - 350
PFEYIYFRSRRLVVWLPDVPADLWWMQGLLRNMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHR    351 - 420
EELGPTHQA                                                                 421 - 429
//

Text Mined References (10)

PMID Year Title
24847357 2014 Genome wide association study of SNP-, gene-, and pathway-based approaches to identify genes influencing susceptibility to Staphylococcus aureus infections.
24613307 2014 Neutral lipid stores and lipase PNPLA5 contribute to autophagosome biogenesis.
19390624 2009 Genetic variance in the adiponutrin gene family and childhood obesity.
19029121 2009 Mammalian patatin domain containing proteins: a family with diverse lipolytic activities involved in multiple biological functions.
17603008 2007 A comparative study of human GS2, its paralogues, and its rat orthologue.
16799181 2006 Characterization of the human patatin-like phospholipase family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.