Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 4.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 5.6e-03
facioscapulohumeral dystrophy -2.000 2.7e-03
interstitial cystitis 1.200 1.8e-02
lung carcinoma -1.300 2.5e-12
malignant mesothelioma -4.300 2.6e-09
subependymal giant cell astrocytoma 1.466 1.6e-02

Protein-protein Interaction (7)

Gene RIF (3)

AA Sequence

MWSHLNRLLFWSIFSSVTCRKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLF      1 - 70
RRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETD     71 - 140
RHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSH    141 - 210
PVTMPSTGGDSCPFCLKLLLPGLLLLLVVIILILAFWVLPKYKTRKAMRNNVPRDRGDTAMEVGIYANIL    211 - 280
EKQAKEESVPEVGSRPCVSTAQDEAKHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF           281 - 343
//

Text Mined References (7)

PMID Year Title