Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 4.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -4.300 0.000
cutaneous lupus erythematosus 1.100 0.006
interstitial cystitis 1.200 0.018
subependymal giant cell astrocytoma 1.466 0.016
lung carcinoma -1.300 0.000
facioscapulohumeral dystrophy -2.000 0.003

Gene RIF (3)

PMID Text
25007884 Data indicate that the rs6504230 polymorphism affects MILR1 (mast cell immunoglobulin-like receptor 1; synonyms, Allergin-1) expression levels, leading to a susceptibility to producing specific IgE antibodies against common allergens.
24552759 It is a immunoglobulin-like receptor which regulates the activation of mast cell.(review)
24116093 Allergin-1S1, a splicing isoform of Allergin-1, is predominantly expressed on human primary MC in both bronchoalveolar lavage fluid and nasal scratching specimens. Moreover, Allergin-1S1 inhibits IgE-mediated activation from human primary MC in BAL fluid.

AA Sequence

MWSHLNRLLFWSIFSSVTCRKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLF      1 - 70
RRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETD     71 - 140
RHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSH    141 - 210
PVTMPSTGGDSCPFCLKLLLPGLLLLLVVIILILAFWVLPKYKTRKAMRNNVPRDRGDTAMEVGIYANIL    211 - 280
EKQAKEESVPEVGSRPCVSTAQDEAKHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF           281 - 343
//

Text Mined References (7)

PMID Year Title
25007884 2014 Influence of MILR1 promoter polymorphism on expression levels and the phenotype of atopy.
24552759 2013 [Immunoglobulin-like receptor, allergin-1 regulates the activation of mast cells].
24116093 2013 Expression and function of Allergin-1 on human primary mast cells.
20526344 2010 An immunoglobulin-like receptor, Allergin-1, inhibits immunoglobulin E-mediated immediate hypersensitivity reactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.