Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.52770215255925E-12
malignant mesothelioma 3163 2.6465677805739E-9
facioscapulohumeral dystrophy 286 0.00266857653924874
cutaneous lupus erythematosus 1056 0.00560910407659757
subependymal giant cell astrocytoma 2287 0.0161280580100521
interstitial cystitis 2299 0.0176596195030881

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -4.300 0.000
cutaneous lupus erythematosus 1.100 0.006
interstitial cystitis 1.200 0.018
subependymal giant cell astrocytoma 1.466 0.016
lung carcinoma -1.300 0.000
facioscapulohumeral dystrophy -2.000 0.003

Synonym

Accession Q7Z6M3 A1L458 B4DUS1 B7ZM50 B9EGN0 D6RUW6 D6RUW8
Symbols MCA32
MCA-32
C17orf60
Allergin-1

Gene

PANTHER Protein Class (1)

  Ortholog (2)

Species Source
Dog OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (3)

PMID Text
25007884 Data indicate that the rs6504230 polymorphism affects MILR1 (mast cell immunoglobulin-like receptor 1; synonyms, Allergin-1) expression levels, leading to a susceptibility to producing specific IgE antibodies against common allergens.
24552759 It is a immunoglobulin-like receptor which regulates the activation of mast cell.(review)
24116093 Allergin-1S1, a splicing isoform of Allergin-1, is predominantly expressed on human primary MC in both bronchoalveolar lavage fluid and nasal scratching specimens. Moreover, Allergin-1S1 inhibits IgE-mediated activation from human primary MC in BAL fluid.

AA Sequence

MWSHLNRLLFWSIFSSVTCRKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLF      1 - 70
RRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETD     71 - 140
RHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSH    141 - 210
PVTMPSTGGDSCPFCLKLLLPGLLLLLVVIILILAFWVLPKYKTRKAMRNNVPRDRGDTAMEVGIYANIL    211 - 280
EKQAKEESVPEVGSRPCVSTAQDEAKHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF           281 - 343
//

Text Mined References (7)

PMID Year Title
25007884 2014 Influence of MILR1 promoter polymorphism on expression levels and the phenotype of atopy.
24552759 2013 [Immunoglobulin-like receptor, allergin-1 regulates the activation of mast cells].
24116093 2013 Expression and function of Allergin-1 on human primary mast cells.
20526344 2010 An immunoglobulin-like receptor, Allergin-1, inhibits immunoglobulin E-mediated immediate hypersensitivity reactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.