Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 3.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.200 1.0e-02
cutaneous lupus erythematosus 1.200 9.6e-03
hepatocellular carcinoma 1.400 1.8e-03
interstitial cystitis 1.500 1.3e-02
interstitial lung disease 1.300 3.0e-02
lung carcinoma -1.300 5.7e-18
mucosa-associated lymphoid tissue lympho... 1.369 4.5e-02
non-small cell lung cancer -1.277 4.7e-18
osteosarcoma -3.706 1.4e-08
ovarian cancer 1.100 7.4e-10
primary Sjogren syndrome 1.700 6.6e-03
psoriasis 1.200 1.4e-09
subependymal giant cell astrocytoma 1.446 1.7e-02
tuberculosis 2.900 2.1e-09
ulcerative colitis 1.100 7.8e-04

Gene RIF (1)

AA Sequence

MKGASEEKLASVSNLVTVFENSRTPEAAPRGQRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSR      1 - 70
RYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQELLETEQAYVARLHLLDQVFFQELLKTARSSK     71 - 140
AFPEDVVRVIFSNISSIYQFHSQFFLPELQRRLDDWTANPRIGDVIQKLAPFLKMYSEYVKNFERAAELL    141 - 210
ATWTDKSPLFQEVLTRIQSSEASGSLTLQHHMLEPVQRIPRYELLLKEYIQKLPAQAPDQADAQKALDMI    211 - 280
FSAAQHSNAAITEMERLQDLWEVYQRLGLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLY    281 - 350
CVPRVIQVGAQFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQRTLELQARSQEEMISWMQAFQAAIDQI    351 - 420
EKRNETFKAAAQGPEGDIQEQELQSEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCA    421 - 490
RCSDYRAELKYDDNRPNRVCLHCYAFLTGNVLPEAKEDKRRGILEKGSSATPDQSLMCSFLQLIGDKWGK    491 - 560
SGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKG    561 - 630
RWVKAMERAASGWSPSWPNDGDLSD                                                 631 - 655
//

Text Mined References (14)

PMID Year Title