Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Ovarian Cysts 34
Disease Target Count P-value
non-small cell lung cancer 2798 4.74297812850027E-18
lung carcinoma 2844 5.72296319296152E-18
ovarian cancer 8492 7.41927225459398E-10
psoriasis 6685 1.42047743473276E-9
tuberculosis 1563 2.09612925171726E-9
osteosarcoma 7933 1.36202211465555E-8
ulcerative colitis 2087 7.79121683396912E-4
hepatocellular carcinoma 550 0.00175738513359568
primary Sjogren syndrome 789 0.0065891461682426
cutaneous lupus erythematosus 1056 0.00955475039398249
astrocytic glioma 2241 0.0103246257635496
subependymal giant cell astrocytoma 2287 0.0166273149849884
interstitial cystitis 2299 0.0269938198850106
interstitial lung disease 292 0.0296042347327977
mucosa-associated lymphoid tissue lymphoma 480 0.0449176039873052

Expression

  Differential Expression (15)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.002
interstitial lung disease 1.300 0.030
astrocytic glioma 1.200 0.010
cutaneous lupus erythematosus 1.200 0.010
osteosarcoma -3.706 0.000
tuberculosis 2.900 0.000
non-small cell lung cancer -1.277 0.000
interstitial cystitis 1.600 0.027
primary Sjogren syndrome 1.700 0.007
subependymal giant cell astrocytoma 1.446 0.017
psoriasis 1.200 0.000
lung carcinoma -1.300 0.000
mucosa-associated lymphoid tissue lympho... 1.369 0.045
ulcerative colitis 1.100 0.001
ovarian cancer 1.100 0.000

Gene RIF (1)

PMID Text
18838382 FGD2 has a role in leukocyte signaling and vesicle trafficking in cells specialized to present antigen in the immune system

AA Sequence

MKGASEEKLASVSNLVTVFENSRTPEAAPRGQRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSR      1 - 70
RYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQELLETEQAYVARLHLLDQVFFQELLKTARSSK     71 - 140
AFPEDVVRVIFSNISSIYQFHSQFFLPELQRRLDDWTANPRIGDVIQKLAPFLKMYSEYVKNFERAAELL    141 - 210
ATWTDKSPLFQEVLTRIQSSEASGSLTLQHHMLEPVQRIPRYELLLKEYIQKLPAQAPDQADAQKALDMI    211 - 280
FSAAQHSNAAITEMERLQDLWEVYQRLGLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLY    281 - 350
CVPRVIQVGAQFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQRTLELQARSQEEMISWMQAFQAAIDQI    351 - 420
EKRNETFKAAAQGPEGDIQEQELQSEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCA    421 - 490
RCSDYRAELKYDDNRPNRVCLHCYAFLTGNVLPEAKEDKRRGILEKGSSATPDQSLMCSFLQLIGDKWGK    491 - 560
SGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKG    561 - 630
RWVKAMERAASGWSPSWPNDGDLSD                                                 631 - 655
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
18838382 2008 FGD2, a CDC42-specific exchange factor expressed by antigen-presenting cells, localizes to early endosomes and active membrane ruffles.
17564959 2007 Mutations in FGD4 encoding the Rho GDP/GTP exchange factor FRABIN cause autosomal recessive Charcot-Marie-Tooth type 4H.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...