Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.95
PubTator Score 7.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000

Synonym

Accession Q7Z6I5 A0AVA8 B2RMW1
Symbols SRG5

Gene

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
24205157 SPATA12 could be induced under UV-C stress.
22981541 AP-1 is founded to be a potential transcriptional activator of SPATA12. The promoter activity of SPATA12 was drastically declined after AP-1 binding site mutation or deletion.
17251597 putative function of SPATA12 is to maintain the cell in a differentiated state and/or to suppress cell proliferation in the human testis.
15603706 Didital differential display can be confirmed by SPATA12 as a novel computational biology-based approach for identification of the testis-specific expression of genes.

AA Sequence

MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCALASCQGPGVLPGAASALPEL      1 - 70
TFQGDVCQSETCQRYLQAAISLDIAVSQINLLGRPSSPPALLIQQGSCEQVIHNSTPQFLGMEDGDNERT     71 - 140
TGWLWRLCEDIDAEPSSTGCSRSNQLTFTEGCFVRSLSTVYSNTHIHTHL                        141 - 190
//

Text Mined References (7)

PMID Year Title
24205157 2013 SPATA12 and its possible role in DNA damage induced by ultraviolet-C.
22981541 2012 Transcriptional regulation of human novel gene SPATA12 promoter by AP-1 and HSF.
17251597 Expression and possible functions of a novel gene SPATA12 in human testis.
15603706 2004 Identification and expression of a novel human testis-specific gene by digital differential display.
15490870 2004 [Molecular cloning and expression analysis of a novel human testis-specific gene].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.