Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.29
PubTator Score 7.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.7e-09
Disease Target Count Z-score Confidence
Male infertility 206 3.415 1.7
Seminoma 15 3.269 1.6
Cryptorchidism 296 3.13 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 4.7e-09

Gene RIF (4)

AA Sequence

MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCALASCQGPGVLPGAASALPEL      1 - 70
TFQGDVCQSETCQRYLQAAISLDIAVSQINLLGRPSSPPALLIQQGSCEQVIHNSTPQFLGMEDGDNERT     71 - 140
TGWLWRLCEDIDAEPSSTGCSRSNQLTFTEGCFVRSLSTVYSNTHIHTHL                        141 - 190
//

Text Mined References (7)

PMID Year Title