Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.19
PubTator Score 3.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
astrocytoma 1146 3.6e-34
oligodendroglioma 2850 8.0e-25
Astrocytoma, Pilocytic 3081 1.5e-05
glioblastoma 5792 1.4e-04
ependymoma 4679 1.1e-02
adult high grade glioma 3801 2.0e-02
group 3 medulloblastoma 4104 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gaucher's disease 26 3.124 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-02
astrocytoma -1.100 3.6e-34
Astrocytoma, Pilocytic -1.500 1.5e-05
ependymoma -1.200 1.1e-02
glioblastoma -2.000 1.4e-04
group 3 medulloblastoma -1.700 2.2e-02
oligodendroglioma -1.100 8.0e-25

Gene RIF (4)

AA Sequence

MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRGGTAVILDIFR      1 - 70
RADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETL     71 - 140
NHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQLRQNHIKPSHSAA    141 - 210
QTWCGSPTPASAPNHKLMAMEQGKTLPSATEDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDG    211 - 280
TNMHLQLVRQEMAVCPEQLSEFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQ    281 - 350
SPLCKAFRHVKVDTLSQPEALSRILVPAAWCTVGRD                                      351 - 386
//

Text Mined References (15)

PMID Year Title