Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.19
PubTator Score 3.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 7.95783178694128E-25
posterior fossa group A ependymoma 1511 4.81482703006254E-8
pilocytic astrocytoma 3086 2.10001291670438E-5
glioblastoma 5572 1.35682178497599E-4
astrocytoma 1493 7.5418491512312E-4
pediatric high grade glioma 2712 0.0042382711837413
group 3 medulloblastoma 2254 0.0220493540068506
Disease Target Count Z-score Confidence
Gaucher's disease 25 3.116 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -1.500 0.000
astrocytoma -1.800 0.001
glioblastoma -2.000 0.000
oligodendroglioma -1.100 0.000
group 3 medulloblastoma -1.700 0.022
pediatric high grade glioma -1.100 0.004
pilocytic astrocytoma -1.500 0.000

Synonym

Accession Q7Z6G3 A2RRG3 O75547 Q6ZSK0 EF-hand calcium-binding protein 2
Symbols EFCBP2
stip-2

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19694902 NECAB2 by its physical interaction with mGlu(5b) receptor modulates receptor function
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRGGTAVILDIFR      1 - 70
RADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETL     71 - 140
NHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQLRQNHIKPSHSAA    141 - 210
QTWCGSPTPASAPNHKLMAMEQGKTLPSATEDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDG    211 - 280
TNMHLQLVRQEMAVCPEQLSEFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQ    281 - 350
SPLCKAFRHVKVDTLSQPEALSRILVPAAWCTVGRD                                      351 - 386
//

Text Mined References (13)

PMID Year Title
26843217 2016 Comparative anatomical distribution of neuronal calcium-binding protein (NECAB) 1 and -2 in rodent and human spinal cord.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19694902 2009 The association of metabotropic glutamate receptor type 5 with the neuronal Ca2+-binding protein 2 modulates receptor function.
17689978 2007 The neuronal Ca(2+) -binding protein 2 (NECAB2) interacts with the adenosine A(2A) receptor and modulates the cell surface expression and function of the receptor.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044471 2002 NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern.
More...