Property Summary

NCBI Gene PubMed Count 14
PubMed Score 169.19
PubTator Score 9.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.800 1.2e-03
ependymoma -1.600 6.8e-03
oligodendroglioma -1.800 3.1e-03
osteosarcoma -2.272 4.9e-05

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MESRVADAGTGETARAAGGSPAVGCTTRGPVVSAPLGAARWKLLRQVLKQKHLDDCLRHVSVRRFESFNL      1 - 70
FSVTEGKERETEEEVGAWVQYTSIFCPEYSISLRHNSGSLNVEDVLTSFDNTGNVCIWPSEEVLAYYCLK     71 - 140
HNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVL    141 - 210
RWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGF    211 - 280
CIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLILTKHG                               281 - 323
//

Text Mined References (19)

PMID Year Title