Property Summary

Ligand Count 28
NCBI Gene PubMed Count 6
PubMed Score 10.15
PubTator Score 3.79

Knowledge Summary

Patent (1,617)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hypotrichosis 1 15 3.233 1.6

Gene RIF (1)

AA Sequence

MSIMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRI      1 - 70
RPSKDSSSFRQAQCLRKDPGANNHLESQGVRGTAGDADRELRGPSEKATAGQPRVTLLPTPHVSGLSQEF     71 - 140
ESHWPEIAERSPCVAGVIPVIYYSVLLGLGLPVSLLTAVALARLATRTRRPSYYYLLALTASDIIIQVVI    141 - 210
VFAGFLLQGAVLARQVPQAVVRTANILEFAANHASVWIAILLTVDRYTALCHPLHHRAASSPGRTRRAIA    211 - 280
AVLSAALLTGIPFYWWLDMWRDTDSPRTLDEVLKWAHCLTVYFIPCGVFLVTNSAIIHRLRRRGRSGLQP    281 - 350
RVGKSTAILLGITTLFTLLWAPRVFVMLYHMYVAPVHRDWRVHLALDVANMVAMLHTAANFGLYCFVSKT    351 - 420
FRATVRQVIHDAYLPCTLASQPEGMAAKPVMEPPGLPTGAEV                                421 - 462
//

Text Mined References (6)

PMID Year Title