Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
Funding $98,725.75
PubMed Score 9.01
PubTator Score 3.79

Knowledge Summary

Patent (1,617)

Expression

AA Sequence

MSIMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQVTGGSWDLRI      1 - 70
RPSKDSSSFRQAQCLRKDPGANNHLESQGVRGTAGDADRELRGPSEKATAGQPRVTLLPTPHVSGLSQEF     71 - 140
ESHWPEIAERSPCVAGVIPVIYYSVLLGLGLPVSLLTAVALARLATRTRRPSYYYLLALTASDIIIQVVI    141 - 210
VFAGFLLQGAVLARQVPQAVVRTANILEFAANHASVWIAILLTVDRYTALCHPLHHRAASSPGRTRRAIA    211 - 280
AVLSAALLTGIPFYWWLDMWRDTDSPRTLDEVLKWAHCLTVYFIPCGVFLVTNSAIIHRLRRRGRSGLQP    281 - 350
RVGKSTAILLGITTLFTLLWAPRVFVMLYHMYVAPVHRDWRVHLALDVANMVAMLHTAANFGLYCFVSKT    351 - 420
FRATVRQVIHDAYLPCTLASQPEGMAAKPVMEPPGLPTGAEV                                421 - 462
//

Text Mined References (5)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15845401 2005 Molecular cloning and characterization of a novel Gq-coupled orphan receptor GPRg1 exclusively expressed in the central nervous system.
14623098 2003 Seven evolutionarily conserved human rhodopsin G protein-coupled receptors lacking close relatives.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.