Property Summary

NCBI Gene PubMed Count 23
PubMed Score 35.89
PubTator Score 24.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.15714898996472E-30
non-small cell lung cancer 2798 7.12696087441349E-13
pilocytic astrocytoma 3086 1.0387984887668E-7
ovarian cancer 8492 6.86451893781412E-7
facioscapulohumeral dystrophy 286 9.25241085815256E-6
lung cancer 4473 6.99906334033657E-5
tuberculosis and treatment for 6 months 686 8.5706356558085E-5
ulcerative colitis 2087 9.90065313447881E-5
primary Sjogren syndrome 789 6.55313239191528E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 7.12399658007253E-4
medulloblastoma, large-cell 6234 0.00103286535242835
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00158255587807065
interstitial cystitis 2299 0.0023984500721815
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00313331591476206
osteosarcoma 7933 0.00616137860551875
group 3 medulloblastoma 2254 0.00618411195898587
fibroadenoma 557 0.0103921674622622
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0107105156670324
adult high grade glioma 2148 0.0225228725819218
ductal carcinoma in situ 1745 0.0252146915247013
invasive ductal carcinoma 2950 0.0356169091768271
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
Disease Target Count Z-score Confidence
Leukocyte adhesion deficiency 15 3.101 1.6

Expression

Synonym

Accession Q7Z5R6 Q8IWS8 Q8IYL7 Q8IZZ7
Symbols RIAM
INAG1
PREL1
RARP1

Gene

PDB

2MWN   3ZDL  

  Ortholog (11)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (12)

PMID Text
26419705 Disruption of the RIAM/lamellipodin-integrin-talin complex markedly impairs cell migration.
23420480 RIAM is a critical component of the phagocytosis machinery downstream of Rap1 and mediates its function by recruiting talin to the phagocytic complement receptors.
23045549 RIAM was recruited to the lymphocyte plasma membrane through its Ras association and pleckstrin homology domains, both of which were required for lymphocyte adhesion.
22946047 integrin-triggered, RIAM-dependent MEK activation represents a key feedback event required for efficient focal adhesion disassembly.
21454517 RIAM might contribute to the dissemination of melanoma cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19952372 by regulating the localization of PLC-gamma1, RIAM plays a central role in TCR signaling and the transcription of target genes.
19098287 a minimized 50-residue Rap-RIAM module containing the talin binding site of RIAM joined to the membrane-targeting sequence of Rap1A. This minimized Rap-RIAM module was sufficient to target talin to the plasma membrane and to mediate integrin activation
17373700 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMAD      1 - 70
LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLP     71 - 140
LPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVVKVHMNDNSTKSLMVDERQLARDVLDNLFEK    141 - 210
THCDCNVDWCLYEIYPELQIERFFEDHENVVEVLSDWTRDTENKILFLEKEEKYAVFKNPQNFYLDNRGK    211 - 280
KESKETNEKMNAKNKESLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTS    281 - 350
RDLACFIQFENVNIYYGTQHKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDTRTLNQWVMGIRIAKYG    351 - 420
KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETS    421 - 490
KDKKPALGNHHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPP    491 - 560
PPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPVP    561 - 630
PKRQENPGHPGGAGGGEQDFMSDLMKALQKKRGNVS                                      631 - 666
//

Text Mined References (28)

PMID Year Title
26419705 2015 A RIAM/lamellipodin-talin-integrin complex forms the tip of sticky fingers that guide cell migration.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23420480 2013 RIAM (Rap1-interacting adaptor molecule) regulates complement-dependent phagocytosis.
23389036 2013 RIAM and vinculin binding to talin are mutually exclusive and regulate adhesion assembly and turnover.
23045549 2012 Rap1-interacting adapter molecule (RIAM) associates with the plasma membrane via a proximity detector.
22946047 2012 Focal adhesion disassembly is regulated by a RIAM to MEK-1 pathway.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
22228203 2012 A genome-wide association study of inflammatory biomarker changes in response to fenofibrate treatment in the Genetics of Lipid Lowering Drug and Diet Network.
21454517 2011 Rap1-GTP-interacting adaptor molecule (RIAM) protein controls invasion and growth of melanoma cells.
More...