Property Summary

NCBI Gene PubMed Count 23
Grant Count 27
R01 Count 8
Funding $4,818,313.91
PubMed Score 35.89
PubTator Score 24.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26419705 Disruption of the RIAM/lamellipodin-integrin-talin complex markedly impairs cell migration.
23420480 RIAM is a critical component of the phagocytosis machinery downstream of Rap1 and mediates its function by recruiting talin to the phagocytic complement receptors.
23045549 RIAM was recruited to the lymphocyte plasma membrane through its Ras association and pleckstrin homology domains, both of which were required for lymphocyte adhesion.
22946047 integrin-triggered, RIAM-dependent MEK activation represents a key feedback event required for efficient focal adhesion disassembly.
21454517 RIAM might contribute to the dissemination of melanoma cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19952372 by regulating the localization of PLC-gamma1, RIAM plays a central role in TCR signaling and the transcription of target genes.
19098287 a minimized 50-residue Rap-RIAM module containing the talin binding site of RIAM joined to the membrane-targeting sequence of Rap1A. This minimized Rap-RIAM module was sufficient to target talin to the plasma membrane and to mediate integrin activation
17373700 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMAD      1 - 70
LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLP     71 - 140
LPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVVKVHMNDNSTKSLMVDERQLARDVLDNLFEK    141 - 210
THCDCNVDWCLYEIYPELQIERFFEDHENVVEVLSDWTRDTENKILFLEKEEKYAVFKNPQNFYLDNRGK    211 - 280
KESKETNEKMNAKNKESLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTS    281 - 350
RDLACFIQFENVNIYYGTQHKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDTRTLNQWVMGIRIAKYG    351 - 420
KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETS    421 - 490
KDKKPALGNHHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPP    491 - 560
PPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSARPPPAVAKRPPVP    561 - 630
PKRQENPGHPGGAGGGEQDFMSDLMKALQKKRGNVS                                      631 - 666
//

Text Mined References (28)

PMID Year Title
26419705 2015 A RIAM/lamellipodin-talin-integrin complex forms the tip of sticky fingers that guide cell migration.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23420480 2013 RIAM (Rap1-interacting adaptor molecule) regulates complement-dependent phagocytosis.
23389036 2013 RIAM and vinculin binding to talin are mutually exclusive and regulate adhesion assembly and turnover.
23045549 2012 Rap1-interacting adapter molecule (RIAM) associates with the plasma membrane via a proximity detector.
22946047 2012 Focal adhesion disassembly is regulated by a RIAM to MEK-1 pathway.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
22228203 2012 A genome-wide association study of inflammatory biomarker changes in response to fenofibrate treatment in the Genetics of Lipid Lowering Drug and Diet Network.
21454517 2011 Rap1-GTP-interacting adaptor molecule (RIAM) protein controls invasion and growth of melanoma cells.
More...