Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.38
PubTator Score 3.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia 1.400 4.2e-02
acute quadriplegic myopathy 1.483 6.4e-06
Amyotrophic lateral sclerosis 1.300 1.1e-06
astrocytic glioma -1.800 1.5e-02
atypical teratoid / rhabdoid tumor -2.300 6.7e-06
gastric carcinoma -1.100 3.3e-02
glioblastoma -1.100 1.3e-02
group 3 medulloblastoma -1.200 1.9e-02
intraductal papillary-mucinous neoplasm ... 1.300 4.6e-02
medulloblastoma, large-cell -3.200 1.6e-03
mucosa-associated lymphoid tissue lympho... 1.127 6.4e-03
non-small cell lung cancer -1.097 1.4e-12
Pick disease -1.100 2.5e-04
progressive supranuclear palsy -1.100 1.4e-02
spina bifida -1.616 2.3e-02

Gene RIF (5)

AA Sequence

MPPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCTGLSVPTSGGGGGGFGGPFSATAVPPPPPPAMNI      1 - 70
PQQQPPPPAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSW     71 - 140
GAMHGRDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPL    141 - 210
QVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPG    211 - 280
TDNLLMLNGRSSLFPIDDGLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITA    281 - 350
SFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP    351 - 420
WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFS    421 - 490
NQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWAN    491 - 560
IHSRAGREFHKPLVKEGADRPRQIHFRWN                                             561 - 589
//

Text Mined References (13)

PMID Year Title