Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.69
PubTator Score 11.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Paraplegia 74 3.315 1.7
Legionnaires' disease 20 3.092 1.5

Expression

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREK      1 - 70
MSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRI     71 - 140
EQVRRSISRLTDVSAQDFSMRPSSSDC                                               141 - 167
//

Text Mined References (11)

PMID Year Title