Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.32
PubTator Score 11.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q7Z5L4 Q8N7A9
Symbols CT132
SPAS1
spergen1

Gene

Gene RIF (2)

PMID Text
20682177 Of the prostate cancer samples, 10, 10, 23 and 40% showed ODF1, ODF2, LEMD1 and SPATA19 specific bands, respectively, but none of the BPH samples expressed any of these genes.
19886887 The SPATA19 and TEX101 genes may be possible targets for cancer immunotherapy and novel markers for early detection of basal cell carcinoma.

AA Sequence

MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREK      1 - 70
MSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRI     71 - 140
EQVRRSISRLTDVSAQDFSMRPSSSDC                                               141 - 167
//

Text Mined References (10)

PMID Year Title
20682177 2010 Expression of two testis-specific genes, SPATA19 and LEMD1, in prostate cancer.
19886887 2010 Elevated expression levels of testis-specific genes TEX101 and SPATA19 in basal cell carcinoma and their correlation with clinical and pathological features.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15139970 2004 Cloning and characterization of a mouse spergen-1 localized in sperm mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12688595 2003 Isolation and expression analysis of the human testis-specific gene, SPERGEN-1, a spermatogenic cell-specific gene-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.