Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.75
PubTator Score 28.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 6.3e-05
osteosarcoma 7950 4.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 6.3e-05
osteosarcoma 1.512 4.1e-04

Synonym

Accession Q7Z5L2 O60598 Q5W0B4 Q5W0B5 Q86VT9 Q8N9H0
Symbols PSORT
GIDRP86
GIDRP88
C10orf28

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MQQESERCRVRARRPDMALYVPKARRGAVLLKTGDEEESCGSPNSVVKEKQKESSLSQKEVFKDKPEARR      1 - 70
LNINPDRKEHNCREEKKSSTKLRMDTCLQKTNRVCSKRGTTESKEVLSQGQQQGAPNAGVITNAPLQRHF     71 - 140
KPKKVECLEVETTDVTGHERILLSQACLEISEAQVPSKPFQNVEFCDFSRHEPDGEAFEDKDLEGRIETD    141 - 210
TKVLEILYEFPRVFSSVMKPENMIVPIKLSSDSEIVQQSMQTSDGILNPSSGGITTTSVPGSPDGVFDQT    211 - 280
CVDFEVESVGGIANSTGFILDQKDTDSIPATMGHISLSESTNDTVSPVMIRECEKNDSTADELHVKHEPP    281 - 350
DTAVLAHETHRDSGFKNVGDITNKACMMDTTGMSCSDHVTVDSPYVVAVRIADETSINTRSFSKFVGMSA    351 - 420
DATPLHVARSGNDTEDFSNPSACSDIYGESISSHFTESTGKLIESLSDCASSLPIKKIAGSNYNTFLDSE    421 - 490
LSMLNGTKVLSDSAVGIDLGSTGDTTEALHELRTAEEFKTEEQDDSGSIEFGVSFPDRESSSMETSIEPK    491 - 560
ATETSHTEGITAIEESWESMFNDDGDCLDPRLLQEGILMHIKPENHCSELSGNTKSRESIQEPRSDYYNH    561 - 630
EVPDIDLSDCEFPHVIEIYDFPQEFHTEDLLRVFCSYQKKGFDIKWVDDTHALGVFSSPITARDALGIKH    631 - 700
TMVKIRPLSQATRAAKAKARAYAEFLQPAKERPETSAALARRLVISALGVRSKQSKTEREAELKKLQEAR    701 - 770
ERKRLEAKQREDIWEGRDQSTV                                                    771 - 792
//

Text Mined References (13)

PMID Year Title