Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.20
PubTator Score 5.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -5.200 0.000
cutaneous lupus erythematosus 1.600 0.003
osteosarcoma -2.336 0.000
ependymoma -1.300 0.000
group 4 medulloblastoma -2.100 0.000
cystic fibrosis 2.947 0.000
medulloblastoma, large-cell -1.400 0.000
atypical teratoid/rhabdoid tumor -1.100 0.001
pilocytic astrocytoma 1.400 0.002
ovarian cancer 1.200 0.002

Synonym

Accession Q7Z5H3 A0AVP7 A5YM75 B4DED8 B9EGA0 C9JDM2 O00152 Q6ZSB0
Symbols RhoGAP2
RhoGap22

Gene

Gene RIF (6)

PMID Text
22952583 a weak complex between RhoGAP protein ARHGAP22 and signal regulatory protein 14-3-3 has 1:2 stoichiometry and a single peptide binding mode
21969604 Identification of RhoGAP22 as an Akt-dependent regulator of cell motility in response to insulin
21926414 The interaction of the IL1RAPL1 family of proteins with PTPdelta and RhoGAP2 reveals a pathophysiological mechanism of cognitive impairment associated with a novel type of trans-synaptic signaling.
21310492 We identified a genetic association for susceptibility to retinopathy in 5 novel chromosomal regions and PLXDC2 and ARHGAP22, the latter 2 of which are genes implicated in endothelial cell angiogenesis and increased capillary permeability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSPKIRQARRARSKSLVMGEQSRSPGRMPCPHRLGPVLKAGWLKKQRSIMKNWQQRWFVLRGDQLFYYK      1 - 70
DKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANPEALLLMASSQRDMEDWVQAI     71 - 140
RRVIWAPLGGGIFGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSF    141 - 210
DCGEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQAN    211 - 280
YNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRKHSQLFT    281 - 350
APVPEGPTSPRGGLQCAVGWGSEEVTRDSQGEPGGPGLPAHRTSSLDGAAVAVLSRTAPTGPGSRCSPGK    351 - 420
KVQTLPSWKSSFRQPRSLSGSPKGGGSSLEVPIISSGGNWLMNGLSSLRGHRRASSGDRLKDSGSVQRLS    421 - 490
TYDNVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSARSSLHTDWALEPSPLPSSSED    491 - 560
PKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSAD    561 - 630
LRKRMSRLEEELDQEKKKYIMLEIKLRNSERAREDAERRNQLLQREMEEFFSTLGSLTVGAKGARAPK      631 - 698
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23593239 2013 The molecular genetic architecture of self-employment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22952583 2012 The weak complex between RhoGAP protein ARHGAP22 and signal regulatory protein 14-3-3 has 1:2 stoichiometry and a single peptide binding mode.
21969604 2011 Identification of RhoGAP22 as an Akt-dependent regulator of cell motility in response to insulin.
21926414 2011 The X-linked intellectual disability protein IL1RAPL1 regulates excitatory synapse formation by binding PTP? and RhoGAP2.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21310492 2011 Genome-wide association study of diabetic retinopathy in a Taiwanese population.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
20585324 2011 Genome-wide association study of conduct disorder symptomatology.
More...