Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.67
PubTator Score 5.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 2.6e-03
atypical teratoid/rhabdoid tumor -1.100 9.3e-04
cutaneous lupus erythematosus 1.600 2.5e-03
cystic fibrosis 1.414 5.7e-05
ependymoma -1.300 1.7e-04
group 4 medulloblastoma -2.100 1.5e-05
malignant mesothelioma -5.200 1.1e-09
medulloblastoma, large-cell -1.400 3.2e-04
osteosarcoma -2.336 1.8e-05
ovarian cancer 1.200 1.9e-03

Gene RIF (6)

AA Sequence

MLSPKIRQARRARSKSLVMGEQSRSPGRMPCPHRLGPVLKAGWLKKQRSIMKNWQQRWFVLRGDQLFYYK      1 - 70
DKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANPEALLLMASSQRDMEDWVQAI     71 - 140
RRVIWAPLGGGIFGQRLEETVHHERKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSF    141 - 210
DCGEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQAN    211 - 280
YNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRKHSQLFT    281 - 350
APVPEGPTSPRGGLQCAVGWGSEEVTRDSQGEPGGPGLPAHRTSSLDGAAVAVLSRTAPTGPGSRCSPGK    351 - 420
KVQTLPSWKSSFRQPRSLSGSPKGGGSSLEVPIISSGGNWLMNGLSSLRGHRRASSGDRLKDSGSVQRLS    421 - 490
TYDNVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSARSSLHTDWALEPSPLPSSSED    491 - 560
PKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSAD    561 - 630
LRKRMSRLEEELDQEKKKYIMLEIKLRNSERAREDAERRNQLLQREMEEFFSTLGSLTVGAKGARAPK      631 - 698
//

Text Mined References (20)

PMID Year Title