Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.54
PubTator Score 1.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.5e-05
ovarian cancer 8520 1.2e-04
dermatomyositis 966 8.3e-04
Breast cancer 3578 4.7e-02
Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 3.327 1.7
Dyslexia 43 3.155 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.800 4.7e-02
dermatomyositis 1.200 8.3e-04
osteosarcoma 1.649 5.5e-05
ovarian cancer -1.700 1.2e-04

Synonym

Accession Q7Z5G4 D3DSX9 J3KQ24 Q96EQ4 Q9P1S0 Q9Y5U7
Symbols GCP16
GOLGA7A
HSPC041
GOLGA3AP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL      1 - 70
ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR        71 - 137
//

Text Mined References (16)

PMID Year Title