Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.13

Knowledge Summary

Patent

No data available

AA Sequence

MHRARWLTPVIPALWEAEAGRSRGQEIETILANKKQSAMPWDQDPEQSTGNYSEDEQNGKQKWREEGEAG      1 - 70
RKREREKEEKNEKELQDEQENKRKRENEKQKQYPEKRLVSKSLMHTLWAKFKLNRCPTIQESLSLSFEFD     71 - 140
MTHKQISQWFCKTRKKYNKEMSKRKHKKKHMRWRSLCCQGWSRTPALK                          141 - 188
//

Text Mined References (3)

PMID Year Title
21679462 2011 The dynamics of vertebrate homeobox gene evolution: gain and loss of genes in mouse and human lineages.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.