Property Summary

NCBI Gene PubMed Count 32
Grant Count 18
R01 Count 17
Funding $2,403,930.34
PubMed Score 30.22
PubTator Score 31.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
subependymal giant cell astrocytoma -1.263 0.029
lung carcinoma 2.200 0.000
Pick disease -1.400 0.000
Breast cancer -2.400 0.000

Gene RIF (18)

PMID Text
26258666 expression of chaperones such as Ric-3 can influence proteins associating with alpha7-nAChRs
23586521 RIC-3 differentially regulates assembly and expression of different nicotinic receptor subunits. These results also show that nicotine-mediated upregulation of alpha4beta2 receptors can be dynamically regulated by the presence of the chaperone, RIC-3.
23153976 RIC-3 gene rs1528133 variation was not found to be effective over any analyzed obesity related parameter, but associated with higher glycemic load, protein and fat eating behavior and antihypertensive drug use
22970690 Xenopus laevis RIC-3 is more effective than either the homomeric human or C. elegans protein in chaperoning the expression of nematode nicotinic receptor ACR-16 in Xenopus oocytes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20522555 RIC-3 exclusively enhances the surface expression of human homomeric 5-hydroxytryptamine type 3A (5-HT3A) receptors despite direct interactions with 5-HT3A, -C, -D, and -E subunits.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18691158 The RIC-3e protein is functionally active and enables surface expression of mature alpha7-nAChRs in cell lines not otherwise permissive for the expression of this receptor.
18471073 we describe the generation and functional and pharmacological characterization of a Chinese hamster ovary (CHO)-K1 cell line co-expressing the human alpha7 nAChR and RIC-3
18246096 this review provides a brief history of RIC-3--REVIEW
More...

AA Sequence

MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAPSDGQTPGARFQRS      1 - 70
HLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHR     71 - 140
KITSFELAQLQEKLKETEAAMEKLINRVGPNGESRAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPE    141 - 210
KEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWES    211 - 280
LPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGIS    281 - 350
TDKAYTGSMLRKRNPQGLE                                                       351 - 369
//

Text Mined References (39)

PMID Year Title
27055476 2016 Evidence of mutations in RIC3 acetylcholine receptor chaperone as a novel cause of autosomal-dominant Parkinson's disease with non-motor phenotypes.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26838027 2016 Multidisciplinary investigation links backward-speech trait and working memory through genetic mutation.
26258666 2015 Resistance to Inhibitors of Cholinesterase 3 (Ric-3) Expression Promotes Selective Protein Associations with the Human ?7-Nicotinic Acetylcholine Receptor Interactome.
24616004 2014 Genetic modifiers of cognitive maintenance among older adults.
23586521 2013 RIC-3 differentially modulates ?4?2 and ?7 nicotinic receptor assembly, expression, and nicotine-induced receptor upregulation.
23153976 Relationship of RIC-3 gene rs1528133 polymorphism with varying degrees of body weight and eating behavior.
22970690 2012 Xenopus laevis RIC-3 enhances the functional expression of the C. elegans homomeric nicotinic receptor, ACR-16, in Xenopus oocytes.
22040696 2012 Chaperoning ?7 neuronal nicotinic acetylcholine receptors.
20668195 2010 Ric-3 promotes alpha7 nicotinic receptor assembly and trafficking through the ER subcompartment of dendrites.
More...