Property Summary

NCBI Gene PubMed Count 34
PubMed Score 30.68
PubTator Score 31.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.3e-33
Pick disease 1894 5.6e-07
Breast cancer 3578 2.9e-05
subependymal giant cell astrocytoma 2287 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count
Retinal Dystrophy and Obesity 2

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.500 2.9e-05
lung carcinoma 2.200 1.3e-33
Pick disease -1.400 5.6e-07
subependymal giant cell astrocytoma -1.263 2.9e-02

Gene RIF (21)

AA Sequence

MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAPSDGQTPGARFQRS      1 - 70
HLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHR     71 - 140
KITSFELAQLQEKLKETEAAMEKLINRVGPNGESRAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPE    141 - 210
KEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWES    211 - 280
LPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGIS    281 - 350
TDKAYTGSMLRKRNPQGLE                                                       351 - 369
//

Text Mined References (41)

PMID Year Title