Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.64
PubTator Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Malignant neoplasm of pancreas 14
Disease Target Count P-value
psoriasis 6685 1.00974329624937E-19
posterior fossa group A ependymoma 1511 3.26154794979469E-7
atypical teratoid / rhabdoid tumor 4369 9.8882586819524E-6
pediatric high grade glioma 2712 2.52989028064577E-4
group 3 medulloblastoma 2254 2.6488952810266E-4
medulloblastoma, large-cell 6234 3.70196483733102E-4
glioblastoma 5572 0.00273056529690154
primary pancreatic ductal adenocarcinoma 1271 0.00410423283938575
ovarian cancer 8492 0.0131219224582345
subependymal giant cell astrocytoma 2287 0.0367288782336237
osteosarcoma 7933 0.044549179085666
Disease Target Count Z-score Confidence
pancreatic cancer 2300 0.0 2.0

Expression

  Differential Expression (12)

Synonym

Accession Q7Z5A7 A6NII9 B0QZ13 B0QZ14 B0QZ15 O95902 Q5H9C4 Q6UWC9 Q8IXR8
Symbols TAFA5
TAFA-5
UNQ5208
QLLK5208

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCAC      1 - 70
RKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS             71 - 132
//

Text Mined References (12)

PMID Year Title
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
22158540 2011 Genome-wide association study identifies five loci associated with susceptibility to pancreatic cancer in Chinese populations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028294 2004 TAFA: a novel secreted family with conserved cysteine residues and restricted expression in the brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...