Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.31
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
adult high grade glioma 3801 8.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Idiopathic scoliosis 31 3.725 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 8.6e-04

AA Sequence

MDNRNTQMYTEEEKTVNPFLPSTPGPKKAKGGGEAVETHPAPGPLPPPEVRDIGERREPDRAQQQPQKPA      1 - 70
VAAGTQSLGNFRQGFMKCLLEVEKMEASHRRASKARSQTAQKSPRTLTPVPTSAPSLPQTPASVPASGPS     71 - 140
WARLPAPGPEPAPMGAPVPTSMPCPVLLGPALDLGWRRMELLHQSSERTLSYAKARQEPEEQSLQKLYQN    141 - 210
REKSEEQLTLKQEEAFRSYFEIFNGPGEVDAQSLKNILLLMGFSVTLAQVEDALMSADVNGDGRVDFKDF    211 - 280
LAVMTDTRRFFCSVEQNALSDMAPHNPHTLLFEILSLLVEMLALPEAVLEEITNYYQKKLKEGTCKAQEM    281 - 350
EAAVGRLRLQKLPYNPQQEESSEVPERKVLSILSRLKQQNYAPNLQSPYAQVPCILLCPQLDKKMVRRQP    351 - 420
SNHYALDQCTPPGLDPDIRSPFFQSGSQGNREHNSDSRKWLSSVPARTH                         421 - 469
//

Text Mined References (4)

PMID Year Title