Property Summary

NCBI Gene PubMed Count 26
PubMed Score 10.88
PubTator Score 13.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 1.2e-05
atypical teratoid/rhabdoid tumor -1.200 8.5e-05
ependymoma -1.200 4.7e-06
group 3 medulloblastoma -1.400 3.8e-03

Gene RIF (13)

AA Sequence

MDLLYGLVWLLTVLLEGISGQGVYAPPTVRIVHSGLACNIEEERYSERVYTIREGETLELTCLVTGHPRP      1 - 70
QIRWTKTAGSASDRFQDSSVFNETLRITNIQRHQGGRYYCKAENGLGSPAIKSIRVDVYYLDDPVVTVHQ     71 - 140
SIGEAKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQGSDKGVEIYEPFFTQGETKILKLKNLRPQD    141 - 210
YANYSCIASVRNVCNIPDKMVSFRLSNKTASPSIKLLVDDPIVVNPGEAITLVCVTTGGEPAPSLTWVRS    211 - 280
FGTLPEKTVLNGGTLTIPAITSDDAGTYSCIANNNVGNPAKKSTNIIVRALKKGRFWITPDPYHKDDNIQ    281 - 350
IGREVKISCQVEAVPSEELTFSWFKNGRPLRSSERMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTCVAS    351 - 420
LKGGGISDISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIELQCQVTGKPKPIILWSRADKEVAMPDGS    421 - 490
MQMESYDGTLRIVNVSREMSGMYRCQTSQYNGFNVKPREALVQLIVQYPPAVEPAFLEIRQGQDRSVTMS    491 - 560
CRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKA    561 - 630
YAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAVDRIVAYRLGIRQAGQQRWWEQEIKINGNIQKGELI    631 - 700
TYNLTELIKPEAYEVRLTPLTKFGEGDSTIRVIKYSAPVNPHLREFHCGFEDGNICLFTQDDTDNFDWTK    701 - 770
QSTATRNTKYTPNTGPNADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSIAPKNPYGPTNTAYCFSFF    771 - 840
YHMYGQHIGVLNVYLRLKGQTTIENPLWSSSGNKGQRWNEAHVNIYPITSFQLIFEGIRGPGIEGDIAID    841 - 910
DVSIAEGECAKQDLATKNSVDGAVGILVHIWLFPIIVLISILSPRR                            911 - 956
//

Text Mined References (26)

PMID Year Title