Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.87
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 6.6e-62
ovarian cancer 8520 4.5e-03
osteosarcoma 7950 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Synovial sarcoma 25 5.801 2.9
Sarcoma 62 3.845 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.706 1.0e-02
ovarian cancer 1.300 4.5e-03
psoriasis 1.200 6.6e-62

Gene RIF (1)

AA Sequence

MGKSRTKRFKRPQFSPTGDCQAEAAAAANGTGGEEDDGPAAELLEKLQHPSAEVRECACAGLARLVQQRP      1 - 70
ALPGLARRDAVRRLGPLLLDPSLAVRETAAGALRNLSACGGFEVCDDMVTKDIMTPLVALLKECSAGLDS     71 - 140
NEMSLQEKKDQNRNSIENIANETVNVLWNICECSSRAVSIFNKEGCLEIVLKYLSRFPTNVDLAISVAYC    141 - 210
LQTVTEDNPELLKSFSATALNMLESALLSPVSSMESLLLKTLVAGTIWNLKDIIPCKSQAEIINALLKIL    211 - 280
SEVLGMDAGEMVIQMKEAETQRLKTAAEAEEILENTNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTD    281 - 350
KELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDESDAFMENSFSECGGQLFSPLCLSHEVHT    351 - 420
ALTNYLIPKKIFEKTAFPNSIAVDLCSRNPTWKPLIRKMNTIQCRALFCLQSLVSLLDVEHLGGAAALQT    421 - 490
LAQHLSQLLFSQPDFAKHVDFLEAISSALRALLQTMASKNISQCMTPDQLMTLCKAGIHSSNVGVRVNVV    491 - 560
SILGITGSVLAKEDGTLETLKNIGCFLLEVTTKDPSLVVAGEALDALFDVFADGKEAERASIQIKLLSAL    561 - 630
KEFQPVFKMKIRKEGRGNYSTDQLCVLDNVKMNLRRFIAYQETVEKRLTS                        631 - 680
//

Text Mined References (12)

PMID Year Title