Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.37
PubTator Score 5.33

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (8)

PMID Text
25682733 study independently replicated finding that rs1537415, variant in glycosyl transferase gene GLT6D1, is associated with AgP and provided 1st report of genetic associations with AgP Sudanese population.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19897590 GLT6D1 is a susceptibility locus for periodontitis.
19897590 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
8218172 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2649653 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2341393 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2283726 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase

AA Sequence

MNSKRMLLLVLFAFSLMLVERYFRNHQVEELRLSDWFHPRKRPDVITKTDWLAPVLWEGTFDRRVLEKHY      1 - 70
RRRNITVGLAVFATGRFAEEYLRPFLHSANKHFMTGYRVIFYIMVDAFFKLPDIEPSPLRTFKAFKVGTE     71 - 140
RWWLDGPLVHVKSLGEHIASHIQDEVDFLFSMAANQVFQNEFGVETLGPLVAQLHAWWYFRNTKNFPYER    141 - 210
RPTSAACIPFGQGDFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGLNSTYEKHLNKYFYLNKPTKLLS    211 - 280
PAYSWDLAFSPPPQIQYVKVAHDSQRKL                                              281 - 308
//

Text Mined References (6)

PMID Year Title
25682733 2015 Replication of the association of GLT6D1 with aggressive periodontitis in a Sudanese population.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19897590 2010 A genome-wide association study identifies GLT6D1 as a susceptibility locus for periodontitis.
19218399 2009 Human pseudogenes of the ABO family show a complex evolutionary dynamics and loss of function.
17298992 2007 Long-term evolution of the CAZY glycosyltransferase 6 (ABO) gene family from fishes to mammals--a birth-and-death evolution model.
15164053 2004 DNA sequence and analysis of human chromosome 9.