Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.49
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.800 0.000
posterior fossa group B ependymoma 2.000 0.000
medulloblastoma 1.200 0.000
atypical teratoid/rhabdoid tumor 1.900 0.000
medulloblastoma, large-cell 1.100 0.010
primitive neuroectodermal tumor 1.100 0.038
pediatric high grade glioma 1.800 0.000
pilocytic astrocytoma 1.700 0.000
lung carcinoma -1.500 0.000
ovarian cancer 1.300 0.006
pancreatic cancer 1.100 0.007

AA Sequence

MRRLPRALLLQLRLALLVAAGAPEVLVSAPRSLVWGPGLQAAVVLPVRYFYLQAVNSEGQNLTRSPAGET      1 - 70
PFKVVVKSLSPKELVRIHVPKPLDRNDGTFLMRYRMYETVDEGLKIEVLYGDEHVAQSPYILKGPVYHEY     71 - 140
CECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGK    141 - 210
YTDFKMFSDEILLSLTRKVLLPDLEFYVNLGDWPLEHRKVNGTPSPIPIISWCGSLDSRDVVLPTYDITH    211 - 280
SMLEAMRGVTNDLLSIQGNTGPSWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKE    281 - 350
KELGKAKLMGFFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQDSPYYEHFYMALEPWKHYVPIKRNL    351 - 420
SDLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPED    421 - 490
STAICQCHRKKPSREEL                                                         491 - 507
//

Text Mined References (7)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.