Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.14
PubTator Score 0.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.8e-03
ovarian cancer -2.200 8.8e-08
pancreatic ductal adenocarcinoma liver m... -1.241 3.5e-02

Gene RIF (1)

AA Sequence

MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQN      1 - 70
FYRQFKEIAAVIETV                                                            71 - 85
//

Text Mined References (16)

PMID Year Title