Property Summary

NCBI Gene PubMed Count 14
PubMed Score 18.82
PubTator Score 17.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 0.000
oligodendroglioma 1.100 0.000
group 4 medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.100 0.011
medulloblastoma, large-cell -2.700 0.000
non-small cell lung cancer -1.284 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.043
pilocytic astrocytoma 1.300 0.000
breast carcinoma -1.100 0.000
Breast cancer -2.000 0.000
ductal carcinoma in situ -1.400 0.001
invasive ductal carcinoma -2.100 0.000
ovarian cancer -4.100 0.000

Synonym

Accession Q7Z449 B2RMV7 Q96EQ6
Symbols SPG49
SPG56
P450TEC

Gene

 MGI Term (1)

Gene RIF (9)

PMID Text
25872594 This is the first report of CYP2E1 and CYP2U1 protein expression in human Amygdala.
25857771 Data suggest that the 3D model could be useful to identify other substrates of cytochrome P450 2U1 (CYP2U1) and help in understanding its physiologic roles.
24563460 human cytochrome P450 2U1 oxidizes endogenous N-arachidonoylserotonin
24337409 The CYP2U1 gene shows a low mutation frequency in a general population of complicated hereditary spastic paraparesis
21707071 CYP1B1 and CYP2U1 were the only quantifiable CYPs in in freshly isolated human brain microvessels.
20630735 Observational study of genotype prevalence. (HuGE Navigator)
20630735 Genetic polymorphism of CYP2U1, a cytochrome P450 involved in fatty acids hydroxylation.
20332099 Observational study of gene-disease association. (HuGE Navigator)
14660610 CYP2U1 plays an important physiological role in fatty acid signaling processes in both cerebellum and thymus

AA Sequence

MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSWLRRRRARGIPPGPTPWPLVG      1 - 70
NFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYGSIFSFFIGHYLVVVLSDFHSVREAL     71 - 140
VQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEM    141 - 210
QKHGEDPFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLP    211 - 280
FGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFDEEYLFYIIGDLF    281 - 350
IAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLA    351 - 420
IPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETFIPFGIGKRVC    421 - 490
MGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAPHPFNITISRR                    491 - 544
//

Text Mined References (16)

PMID Year Title
25872594 2015 Expression of CYP2E1 and CYP2U1 proteins in amygdala and prefrontal cortex: influence of alcoholism and smoking.
25857771 2015 Expression in yeast, new substrates, and construction of a first 3D model of human orphan cytochrome P450 2U1: Interpretation of substrate hydroxylation regioselectivity from docking studies.
24563460 2014 Oxidation of endogenous N-arachidonoylserotonin by human cytochrome P450 2U1.
24337409 2014 Mutations in CYP2U1, DDHD2 and GBA2 genes are rare causes of complicated forms of hereditary spastic paraparesis.
23176821 2012 Alteration of fatty-acid-metabolizing enzymes affects mitochondrial form and function in hereditary spastic paraplegia.
21707071 2011 Transcriptomic and quantitative proteomic analysis of transporters and drug metabolizing enzymes in freshly isolated human brain microvessels.
20630735 2010 Genetic polymorphism of CYP2U1, a cytochrome P450 involved in fatty acids hydroxylation.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
15752708 2005 Expression patterns of mouse and human CYP orthologs (families 1-4) during development and in different adult tissues.
15588491 2004 'Frankenstein genes', or the Mad Magazine version of the human pseudogenome.
More...