Property Summary

NCBI Gene PubMed Count 19
PubMed Score 20.63
PubTator Score 17.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 7.8e-18
Astrocytoma, Pilocytic 1.200 1.2e-08
atypical teratoid / rhabdoid tumor -1.100 1.1e-02
Breast cancer -2.000 5.4e-24
breast carcinoma -1.100 1.7e-22
ductal carcinoma in situ -1.400 1.4e-03
group 3 medulloblastoma -1.500 5.5e-03
intraductal papillary-mucinous carcinoma... -1.200 4.3e-02
invasive ductal carcinoma -2.100 8.8e-05
medulloblastoma, large-cell -2.700 6.3e-05
non-small cell lung cancer -1.284 1.8e-16
oligodendroglioma 1.100 5.1e-10
ovarian cancer -4.100 1.7e-13

 MGI Phenotype (1)

Gene RIF (14)

AA Sequence

MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSWLRRRRARGIPPGPTPWPLVG      1 - 70
NFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYGSIFSFFIGHYLVVVLSDFHSVREAL     71 - 140
VQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEM    141 - 210
QKHGEDPFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLP    211 - 280
FGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFDEEYLFYIIGDLF    281 - 350
IAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLA    351 - 420
IPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETFIPFGIGKRVC    421 - 490
MGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAPHPFNITISRR                    491 - 544
//

Text Mined References (21)

PMID Year Title