Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.30
PubTator Score 6.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 0.000
active ulcerative colitis 1.230 0.006
Breast cancer 1.100 0.000

Gene RIF (34)

PMID Text
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
24086760 HIV-1 Tat binding to NMDA receptors results in subsequent loss of postsynaptic densities and an NMDA receptor antagonist inhibits this loss
23267846 HIV-1 Tat binding to NMDA receptors results in subsequent loss of postsynaptic densities and an NMDA receptor antagonist inhibits this loss
22552781 HIV-1 Tat binding to NMDA receptors results in subsequent loss of postsynaptic densities and an NMDA receptor antagonist inhibits this loss
22240901 The role of TMBIM3/GRINA in the control of cell death in cellular and animal models of ER stress possibly owing to the regulation of ER calcium homeostasis.
22114277 HIV-1 Tat binding to NMDA receptors results in subsequent loss of postsynaptic densities and an NMDA receptor antagonist inhibits this loss
21948112 HIV-1 Tat binding to NMDA receptors results in subsequent loss of postsynaptic densities and an NMDA receptor antagonist inhibits this loss
21948112 HIV-1 Tat binding to NMDA receptors results in subsequent loss of postsynaptic densities and an NMDA receptor antagonist inhibits this loss
20837469 Data showed that GRINA-C was associated with Gb3 synthase, and may demonstrate a new type of posttranscriptional regulation of glycosyltransferases.
19526283 HIV-1 Tat binding to NMDA receptors results in subsequent loss of postsynaptic densities and an NMDA receptor antagonist inhibits this loss
More...

AA Sequence

MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYP      1 - 70
QGPYPQGGYPQGPYPQEGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPQVFPGQDPDSPQHGNYQEEGPPS     71 - 140
YYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFIS    141 - 210
LIVLSCCGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFT    211 - 280
SCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALN    281 - 350
LYTDIINIFLYILTIIGRAKE                                                     351 - 371
//

Text Mined References (13)

PMID Year Title
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
22240901 2012 TMBIM3/GRINA is a novel unfolded protein response (UPR) target gene that controls apoptosis through the modulation of ER calcium homeostasis.
20837469 2010 Transmembrane BAX inhibitor motif containing (TMBIM) family proteins perturbs a trans-Golgi network enzyme, Gb3 synthase, and reduces Gb3 biosynthesis.
19784873 2009 LFG: a candidate apoptosis regulatory gene family.
18440869 2008 Comparative genomics and function analysis on BI1 family.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...