Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
R01 Count 5
Funding $258,521.56
PubMed Score 4.50
PubTator Score 3.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Antisocial personality disorder 9 4.574 2.3

Expression

Gene RIF (5)

PMID Text
24756697 These effects were mediated by the efficient conversion of pro-uPA to active uPA and high phosphorylation levels of ERK detected in the PANC-1 cells expressing exogenous polyserase-1.
23229837 SNP rs4806846 in TMPRSS9 gene is associated with neuroticism in a European sample.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16872279 The isolation and characterization of serase-1B, a splice variant of polyserase-1, is reported (accession AB109390.1).
12886014 Polyserase-I is a human polyprotease with the ability to generate independent serine protease domains from a single translation product

AA Sequence

MEPTVADVHLVPRTTKEVPALDAACCRAASIGVVATSLVVLTLGVLLAFLSTQGFHVDHTAELRGIRWTS      1 - 70
SLRRETSDYHRTLTPTLEALLHFLLRPLQTLSLGLEEELLQRGIRARLREHGISLAAYGTIVSAELTGRH     71 - 140
KGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECDDQEDCSDGSDEAHCECGLQPAWRMAGRIVGGMEAS    141 - 210
PGEFPWQASLRENKEHFCGAAIINARWLVSAAHCFNEFQDPTKWVAYVGATYLSGSEASTVRAQVVQIVK    211 - 280
HPLYNADTADFDVAVLELTSPLPFGRHIQPVCLPAATHIFPPSKKCLISGWGYLKEDFLVKPEVLQKATV    281 - 350
ELLDQALCASLYGHSLTDRMVCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV    351 - 420
YARVTRLRDWILEATTKASMPLAPTMAPAPAAPSTAWPTSPESPVVSTPTKSMQALSTVPLDWVTVPKLQ    421 - 490
ECGARPAMEKPTRVVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVEQVRAHLGT    491 - 560
ASLLGLGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELASPLAFNKYIQPVCLPLAIQKFPVGRKCMISG    561 - 630
WGNTQEGNATKPELLQKASVGIIDQKTCSVLYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEEAPGVF    631 - 700
YLAGIVSWGIGCAQVKKPGVYTRITRLKGWILEIMSSQPLPMSPPSTTRMLATTSPRTTAGLTVPGATPS    701 - 770
RPTPGAASRVTGQPANSTLSAVSTTARGQTPFPDAPEATTHTQLPDCGLAPAALTRIVGGSAAGRGEWPW    771 - 840
QVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGAEGQLERVARIYKHPFYNLY    841 - 910
TLDYDVALLELAGPVRRSRLVRPICLPEPAPRPPDGTRCVITGWGSVREGGSMARQLQKAAVRLLSEQTC    911 - 980
RRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVR    981 - 1050
GWIGQHIQE                                                                1051 - 1059
//

Text Mined References (7)

PMID Year Title
24756697 2014 Polyserase-1/TMPRSS9 induces pro-tumor effects in pancreatic cancer cells by activation of pro-uPA.
23229837 2013 TMPRSS9 and GRIN2B are associated with neuroticism: a genome-wide association study in a European sample.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16872279 2006 Serase-1B, a new splice variant of polyserase-1/TMPRSS9, activates urokinase-type plasminogen activator and the proteolytic activation is negatively regulated by glycosaminoglycans.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12886014 2003 Polyserase-I, a human polyprotease with the ability to generate independent serine protease domains from a single translation product.